ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

23063

Name

WAPAL

Synonym

FOE|KIAA0261|WAPL;wings apart-like homolog (Drosophila);WAPAL;wings apart-like homolog (Drosophila)

Definition

friend of EBNA2 (Epstein-Barr virus nuclear protein 2)|friend of EBNA2 protein|wings apart-like protein homolog

Position

10q23.2

Gene Type

protein-coding

External Links

Links to cell senescence gene database

23063

Links to epithelial mesenchymal transition gene database

23063

Links to ovarian cancer gene database

23063

Links to endometrial cancer gene database

23063

Links to iHOP

23063

Sequence Information

Nucleotide Sequence

>23063 : length: 6352
CGCGCGGGGACTGTGGGAAGCGGAGTGACGGAGCGAGCGGCTGTTGGAGGAAGGAGGTGG
GGGCCGGGAGCGCAAATGGCGTTGAGATGGTTCAGGGCCCTGTTCAAACTCCAGCACTGA
CCATTCACCGGCGGAAGCGGCGGCGCAGGAGGCGGCGGCGGCCCAGCGGGGGCACACAGC
AGGCTCTGTTACCAGCTCCAGCAGTGGCGGCCAGCGAGAGCTAGGCCTGGGCCCGGCCGG
CGGCGCTCGAGGCGGGGAGGGAAGTTGCGGGGCCGCCGCTCCTGCCCCCCCAACCGGGCT
TCCTATTTACCGAAAGCAGAGTCCCTCGCCTCTCTCGGCTCTCACCTGCCGGCCCTGCTC
TCCCGCGCGAGGGTTCCGCGCCCGCCCGCGGGCCGTAGGGAGCGGGAGAGGCGGAGGCGG
CCCGTGGCCAAAGCACCCGCCAGGCTCCGAGGAGAATATGAAACTGGTGTCAAAATGACA
TCCAGATTTGGGAAAACATACAGTAGGAAAGGTGGAAATGGCAGTTCAAAATTCGATGAA
GTCTTTTCCAACAAACGGACTACCCTTAGCACAAAATGGGGAGAGACCACATTTATGGCT
AAATTAGGGCAGAAGAGGCCCAATTTCAAACCAGATATCCAAGAAATTCCGAAGAAACCT
AAAGTGGAAGAAGAAAGTACTGGAGATCCTTTTGGATTTGATAGTGATGATGAGTCTCTA
CCAGTTTCTTCAAAGAATTTAGCCCAGGTTAAGTGTTCCTCTTATTCAGAATCTAGTGAA
GCTGCTCAGTTGGAAGAGGTCACTTCAGTACTTGAAGCTAATAGCAAAATTAGTCATGTG
GTCGTTGAAGACACTGTCGTTTCTGATAAATGCTTCCCTTTGGAGGACACTTTACTTGGG
AAAGAAAAGAGCACAAACCGAATTGTAGAAGATGATGCAAGCATAAGTAGCTGTAATAAA
TTAATAACTTCAGATAAAGTGGAGAATTTTCATGAAGAACATGAAAAGAATAGTCACCAT
ATTCACAAAAATGCTGATGACAGTACTAAGAAACCCAATGCAGAAACTACAGTGGCTTCT
GAAATCAAGGAAACAAATGATACTTGGAACTCCCAGTTTGGGAAAAGGCCAGAATCACCA
TCAGAAATATCTCCAATCAAGGGATCTGTTAGAACTGGTTTGTTTGAATGGGATAATGAT
TTTGAAGATATCAGATCAGAAGACTGTATTTTAAGTTTGGATAGTGATCCCCTTTTGGAG
ATGAAGGATGACGATTTTAAAAATCGATTGGAAAATCTGAATGAAGCCATTGAGGAAGAT
ATTGTACAAAGTGTTCTTAGGCCAACCAACTGTAGGACGTACTGTAGGGCCAATAAAACG
AAATCCTCCCAAGGAGCATCAAATTTTGATAAGCTGATGGACGGCACCAGTCAGGCCTTA
GCCAAAGCAAACAGTGAATCGAGTAAAGATGGCCTGAATCAGGCAAAGAAAGGGGGTGTA
AGTTGTGGGACCAGTTTTAGAGGGACAGTTGGACGGACTAGAGATTACACTGTTTTACAT
CCATCTTGCTTGTCAGTTTGTAATGTTACCATACAGGATACTATGGAACGCAGCATGGAT
GAGTTCACTGCATCCACTCCTGCAGATTTGGGAGAAGCTGGTCGTCTCAGAAAAAAGGCA
GATATTGCAACTTCTAAGACTACTACTAGATTTCGACCTAGTAATACTAAATCCAAAAAG
GATGTTAAACTTGAATTTTTTGGTTTTGAAGATCATGAGACAGGAGGTGATGAAGGAGGT
TCTGGAAGTTCTAATTACAAAATTAAGTATTTTGGCTTTGATGATCTCAGTGAAAGCGAA
GATGATGAAGATGATGACTGTCAAGTAGAAAGAAAGACAAGCAAAAAAAGAACTAAAACA
GCTCCATCACCCTCCTTGCAGCCTCCCCCAGAAAGCAATGATAATTCCCAGGACAGTCAG
TCTGGTACTAACAATGCAGTTTTGATTACCATTTCAGAAAACTTGGATTTTACAGAGGAC
TTGCCTGGTGTGCCTGAAAGTGTGAAGAAGCCCATAAATAAACAAGGAGATAAATCAAAG
GAAAATACCAGAAAGATTTTTAGTGGCCCCAAACGGTCACCCACAAAAGCTGTATATAAT
GCCAGACATTGGAATCATCCAGATTCAGAAGAACTGCCTGGGCCACCAGTAGTAAAACCT
CAGAGTGTCACAGTGAGGCTGTCTTCAAAGGAACCAAATCAAAAAGATGATGGAGTTTTT
AAGGCTCCTGCACCACCATCCAAAGTGATAAAAACTGTGACAATACCTACTCAGCCCTAC
CAAGATATAGTTACTGCACTGAAATGCAGACGAGAAGACAAAGAATTATATACTGTTGTT
CAGCACGTGAAGCACTTCAACGATGTTGTAGAATTTGGTGAAAATCAAGAGTTCACTGAT
GACATTGAGTACTTGTTAAGTGGCTTAAAGAGCACTCAGCCTCTAAACACACGTTGCCTT
AGTGTTATTAGCTTGGCTACTAAATGTGCCATGCCCAGTTTTCGAATGCACCTGAGAGCA
CATGGGATGGTAGCAATGGTCTTTAAAACCTTGGATGATTCCCAGCACCATCAGAATCTG
TCCCTCTGTACAGCTGCCCTCATGTATATACTGAGTAGAGATCGTTTGAACATGGATCTT
GATAGAGCTAGCTTAGATCTAATGATTCGACTTTTGGAACTGGAACAAGATGCTTCATCA
GCCAAGCTACTGAATGAAAAAGACATGAACAAAATTAAAGAAAAAATCCGAAGGCTCTGT
GAAACTGTACACAACAAGCATCTTGATCTAGAAAATATAACGACTGGGCATTTAGCTATG
GAGACATTATTATCCCTTACTTCTAAACGAGCAGGAGACTGGTTTAAAGAAGAACTCCGG
CTTTTGGGTGGTCTGGATCATATTGTAGATAAAGTAAAAGAATGTGTGGATCATTTAAGT
AGAGATGAGGATGAAGAGAAACTGGTAGCCTCACTATGGGGAGCAGAGAGATGTTTACGA
GTTTTAGAAAGTGTAACTGTGCATAATCCCGAAAATCAAAGCTACTTGATAGCATATAAA
GATTCCCAACTTATTGTTTCATCAGCTAAAGCATTACAGCATTGTGAAGAACTGATTCAG
CAGTACAACCGTGCTGAGGACAGCATATGCTTAGCTGACAGTAAGCCTCTGCCTCACCAG
AATGTAACTAACCATGTAGGCAAAGCAGTGGAGGACTGCATGAGGGCCATCATCGGGGTG
TTGCTTAATTTAACTAATGATAATGAGTGGGGCAGCACCAAAACAGGAGAGCAGGACGGT
CTCATAGGCACAGCGCTGAACTGTGTGCTTCAGGTTCCAAAGTACCTACCTCAGGAGCAG
AGATTTGATATTCGAGTGCTGGGCTTAGGTCTGCTGATAAATCTAGTGGAGTATAGTGCT
CGGAATCGGCACTGTCTTGTCAACATGGAAACATCGTGCTCTTTTGATTCTTCCATCTGT
AGTGGAGAAGGGGATGATAGTTTAAGGATAGGTGGACAAGTTCATGCTGTCCAGGCTTTA
GTGCAGCTATTCCTTGAGCGAGAGCGGGCAGCCCAGCTAGCAGAAAGTAAAACAGATGAG
TTGATCAAAGATGCTCCCACCACTCAGCATGATAAGAGTGGAGAGTGGCAAGAAACAAGT
GGAGAAATACAGTGGGTGTCAACTGAAAAGACTGATGGTACAGAAGAGAAACATAAGAAG
GAGGAGGAGGATGAAGAACTTGACCTCAATAAAGCCCTTCAGCATGCCGGCAAACACATG
GAGGATTGCATTGTGGCCTCCTACACAGCACTACTTCTTGGGTGTCTCTGCCAGGAAAGT
CCAATCAATGTAACCACTGTGCGGGAATATCTGCCAGAAGGAGACTTTTCAATAATGACA
GAGATGCTCAAAAAATTTTTGAGTTTTATGAATCTCACTTGTGCTGTTGGAACAACTGGC
CAGAAATCTATCTCTAGAGTGATTGAATATTTGGAACATTGCTAGCTGCTTTACCTTTGC
TTCAGGTGCTCGGTAATGCTGGAGCTATCCTTAGACAAAGAAAAGTCAAGTCATGAAAGA
AGTCCTTGAAGATATACCAAGAACATTCATCAGTATCATTCGTGTTTGGATTTTTAAGGC
CACCTGATTTCTTCGTCATGCATTCGGCATTTGCTAAATGACAGTTACTACATCAATCTG
CAACTATCAAAAATGAGGGGAAAAGGTTCAGGCTGTTAACAATTCCATGCAGTATTTAAA
TACATTTACTTTGGCAGAGTTTATACCCTCCCCTTGTTTTCTTGCTTTATTCTGGGCAAG
TTTGAAGGGGAAAATTTGTGCTGCTGTTAGTGCAACTGCTGTGTATGTTGAGCCACTGTT
GTCATGCCAGCCAGGTGCAAAGGCAGCTTAGCTACTGAGGTAGCGAATGTTCTGAGGACA
TTCTAGACAACAGCTTAGTTCCTTTTTCAGGCTCATTTGCTTTTGCTTTTTTGTTGAATG
ATTCCAATCGTAAATAAAGCTTTTAATAATTTTGTGAATTTTTTGGTTGTTGTTCCCTGA
ACTACTGTCTATATTTAAAATTAGATGGAATCCAAAGATACACGGGATTAATAGTATATT
TTTTTATTCTTGATTAGGTTTGGGTTATTGAACTATTTTTTACTTTTGAGACCACAACCA
TATTCAATATCATACCATAATGTGTCATAGCTATAGGCACAAGAAAAACAACAGTTTGAG
AGAATATTATATAAGATGATGTGCCCTGTTAAAAGGAGGAGGCAAAATAGTCAAACCCAG
GGTAGTTTACACTTAATGCTAGGGAGGCTCTTAAAACATTATTAGATTTTGAGGAAAGAC
TCTCTAGATATATTTTCTAATGTTCAGTACAATAAATATAAGGAAGCTAAAACACCAATG
TGGAATTCCTGTTTCCAGATAACATGTATATTCTTCTATAGAGTGACAGGATCAATTGCA
TAAGCGCAAAGCCTTAAATTGCTGGTTTAGAGAAGACCCTTTTTTCATTCAGATTCTTTG
TTCGTAGAGCAGTTATTTGAAAAACAGTTATGGAACACAAAACATTTTATAGATTTAATA
TCATAACATTGCAAATTTTTCTTGTATTATTCACACCACTGGTTATACTTTTTTTTTTCC
TTTTTTATTGATTGGGCCTGAATACAGGCTTTCTAGAGATCTTTTTCATTAATACTTTTA
AATACCTTTCAGGTAGTTACATCATGTTTCTTCATTGGATTTGTAAAACTTGAAGCCATA
AAAATATTAGTTTGGTGTGTATTGGGGAAAATAGCTAAAAGTCTAATTTTTACCCATTTA
GACTTTGTTATTTCCTTGTATAAAGTGACAAATCGGGGCTCTTGTATCAGTGCCAGCTGT
AATGTTTTTAAATGCAGTGGCTGCCTTCTATTGTCTTCCTATTTTTGATAATGCAGATTG
TTGGGAAATCTGTAAGGAAGTAACTGATTCCAGGCAAATTGTTTTCTTCCTTCTACCCAC
CCCAACCCCTACCCATCACCTTTTAAGAACATAGTACGCCAGTGTAACGTGGGAACCATT
GAGATTGTATTTGCCCTGAGTATTAAAGCTAGCTTAGCAAAATACTTTTAAAAACATATT
GGTAAATGATACCCGTAAAATTAAATTAGTTATATTTTATTTTAAAATGCAAAATACATT
GATATTTATTAATCATTGGATTTAGGGAAAGGGACAGATTTTTGGTGAACCTGACTTGTG
GCAGATGGTAAGGAATATTATAAAACATTTGGATGAGAACAATCAGGGCGAACTGCATTT
TTCTGTTACACTGGTAATCATTTGAAAATTGATTTACCTCAGTGTTTAACAGTTTTTTGT
TTTGTTTTGTTTTTTAAATAATAACTAATTGTCGAGCACTGATAGAGATGCAGATTTTGG
TGGGGGGAGGTGGTGGGGGAGATAATCACTTCACCAACTGCAGTGCATTTGTGTGTTTTT
AACCCTCAGAGAACTCTGCATTTTAGGGTACTTGAGGCTGACTTAACTAAAAGTTTTAAA
GTAACCTTTTTTCCATTGTAAATATTTCTGTAAATACTACCAATTGGAAATTAGAACAGT
AGAGTACTTTTCTGAATCCAATCCTATTTTTATTTTATACAGTATTTCTCAGCTGTGATC
TTTGGAGCAAAAGCCAACGGCAGGAAAAAATAGTTTGTACCAGTTTCATGAAGTATGTCT
TTGGGTTTTTGTAAATAATTTTAACTCAAATAAAATTGCTACTTTCAATACA

Protein Sequence

>23063 : length: 1196
MTSRFGKTYSRKGGNGSSKFDEVFSNKRTTLSTKWGETTFMAKLGQKRPNFKPDIQEIPK
KPKVEEESTGDPFGFDSDDESLPVSSKNLAQVKCSSYSESSEAAQLEEVTSVLEANSKIS
HVVVEDTVVSDKCFPLEDTLLGKEKSTNRIVEDDASISSCNKLITSDKVENFHEEHEKNS
HHIHKNADDSTKKPNAETTVASEIKETNDTWNSQFGKRPESPSEISPIKGSVRTGLFEWD
NDFEDIRSEDCILSLDSDPLLEMKDDDFKNRLENLNEAIEEDIVQSVLRPTNCRTYCRAN
KTKSSQGASNFDKLMDGTSQALAKANSESSKDGLNQAKKGGVSCGTSFRGTVGRTRDYTV
LHPSCLSVCNVTIQDTMERSMDEFTASTPADLGEAGRLRKKADIATSKTTTRFRPSNTKS
KKDVKLEFFGFEDHETGGDEGGSGSSNYKIKYFGFDDLSESEDDEDDDCQVERKTSKKRT
KTAPSPSLQPPPESNDNSQDSQSGTNNAVLITISENLDFTEDLPGVPESVKKPINKQGDK
SKENTRKIFSGPKRSPTKAVYNARHWNHPDSEELPGPPVVKPQSVTVRLSSKEPNQKDDG
VFKAPAPPSKVIKTVTIPTQPYQDIVTALKCRREDKELYTVVQHVKHFNDVVEFGENQEF
TDDIEYLLSGLKSTQPLNTRCLSVISLATKCAMPSFRMHLRAHGMVAMVFKTLDDSQHHQ
NLSLCTAALMYILSRDRLNMDLDRASLDLMIRLLELEQDASSAKLLNEKDMNKIKEKIRR
LCETVHNKHLDLENITTGHLAMETLLSLTSKRAGDWFKEELRLLGGLDHIVDKVKECVDH
LSRDEDEEKLVASLWGAERCLRVLESVTVHNPENQSYLIAYKDSQLIVSSAKALQHCEEL
IQQYNRAEDSICLADSKPLPHQNVTNHVGKAVEDCMRAIIGVLLNLTNDNEWGSTKTGEQ
DGLIGTALNCVLQVPKYLPQEQRFDIRVLGLGLLINLVEYSARNRHCLVNMETSCSFDSS
ICSGEGDDSLRIGGQVHAVQALVQLFLERERAAQLAESKTDELIKDAPTTQHDKSGEWQE
TSGEIQWVSTEKTDGTEEKHKKEEEDEELDLNKALQHAGKHMEDCIVASYTALLLGCLCQ
ESPINVTTVREYLPEGDFSIMTEMLKKFLSFMNLTCAVGTTGQKSISRVIEYLEHC