ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2305

Name

FOXM1

Synonym

FKHL16|FOXM1B|HFH-11|HFH11|HNF-3|INS-1|MPHOSPH2|MPP-2|MPP2|PIG29|TGT3|TRIDENT;forkhead box M1;FOXM1;forkhead box M1

Definition

Forkhead, drosophila, homolog-like 16|HNF-3/fork-head homolog 11|M-phase phosphoprotein 2|MPM-2 reactive phosphoprotein 2|forkhead box protein M1|forkhead-related protein FKHL16|hepatocyte nuclear factor 3 forkhead homolog 11|transcription factor Trident|

Position

12p13

Gene Type

protein-coding

Pathways and Diseases

Pathway

FOXM1 transcription factor network;PID Curated;200120

Disease

Cancer;FunDO

External Links

Links to cell senescence gene database

2305

Links to epithelial mesenchymal transition gene database

2305

Links to ovarian cancer gene database

2305

Links to endometrial cancer gene database

2305

Links to iHOP

2305

Sequence Information

Nucleotide Sequence

>2305 : length: 3665
TTTCAAACAGCGGAACAAACTGAAAGCTCCGGTGCCAGACCCCACCCCCGGCCCCGGCCC
GGGACCCCCTCCCCTCCCGGGATCCCCCGGGGTTCCCACCCCGCCCGCACCGCCGGGGAC
CCGGCCGGTCCGGCGCGAGCCCCCGTCCGGGGCCCTGGCTCGGCCCCCAGGTTGGAGGAG
CCCGGAGCCCGCCTTCGGAGCTACGGCCTAACGGCGGCGGCGACTGCAGTCTGGAGGGTC
CACACTTGTGATTCTCAATGGAGAGTGAAAACGCAGATTCATAATGAAAACTAGCCCCCG
TCGGCCACTGATTCTCAAAAGACGGAGGCTGCCCCTTCCTGTTCAAAATGCCCCAAGTGA
AACATCAGAGGAGGAACCTAAGAGATCCCCTGCCCAACAGGAGTCTAATCAAGCAGAGGC
CTCCAAGGAAGTGGCAGAGTCCAACTCTTGCAAGTTTCCAGCTGGGATCAAGATTATTAA
CCACCCCACCATGCCCAACACGCAAGTAGTGGCCATCCCCAACAATGCTAATATTCACAG
CATCATCACAGCACTGACTGCCAAGGGAAAAGAGAGTGGCAGTAGTGGGCCCAACAAATT
CATCCTCATCAGCTGTGGGGGAGCCCCAACTCAGCCTCCAGGACTCCGGCCTCAAACCCA
AACCAGCTATGATGCCAAAAGGACAGAAGTGACCCTGGAGACCTTGGGACCAAAACCTGC
AGCTAGGGATGTGAATCTTCCTAGACCACCTGGAGCCCTTTGCGAGCAGAAACGGGAGAC
CTGTGCAGATGGTGAGGCAGCAGGCTGCACTATCAACAATAGCCTATCCAACATCCAGTG
GCTTCGAAAGATGAGTTCTGATGGACTGGGCTCCCGCAGCATCAAGCAAGAGATGGAGGA
AAAGGAGAATTGTCACCTGGAGCAGCGACAGGTTAAGGTTGAGGAGCCTTCGAGACCATC
AGCGTCCTGGCAGAACTCTGTGTCTGAGCGGCCACCCTACTCTTACATGGCCATGATACA
ATTCGCCATCAACAGCACTGAGAGGAAGCGCATGACTTTGAAAGACATCTATACGTGGAT
TGAGGACCACTTTCCCTACTTTAAGCACATTGCCAAGCCAGGCTGGAAGAACTCCATCCG
CCACAACCTTTCCCTGCACGACATGTTTGTCCGGGAGACGTCTGCCAATGGCAAGGTCTC
CTTCTGGACCATTCACCCCAGTGCCAACCGCTACTTGACATTGGACCAGGTGTTTAAGCC
ACTGGACCCAGGGTCTCCACAATTGCCCGAGCACTTGGAATCACAGCAGAAACGACCGAA
TCCAGAGCTCCGCCGGAACATGACCATCAAAACCGAACTCCCCCTGGGCGCACGGCGGAA
GATGAAGCCACTGCTACCACGGGTCAGCTCATACCTGGTACCTATCCAGTTCCCGGTGAA
CCAGTCACTGGTGTTGCAGCCCTCGGTGAAGGTGCCATTGCCCCTGGCGGCTTCCCTCAT
GAGCTCAGAGCTTGCCCGCCATAGCAAGCGAGTCCGCATTGCCCCCAAGGTTTTTGGGGA
ACAGGTGGTGTTTGGTTACATGAGTAAGTTCTTTAGTGGCGATCTGCGAGATTTTGGTAC
ACCCATCACCAGCTTGTTTAATTTTATCTTTCTTTGTTTATCAGTGCTGCTAGCTGAGGA
GGGGATAGCTCCTCTTTCTTCTGCAGGACCAGGGAAAGAGGAGAAACTCCTGTTTGGAGA
AGGGTTTTCTCCTTTGCTTCCAGTTCAGACTATCAAGGAGGAAGAAATCCAGCCTGGGGA
GGAAATGCCACACTTAGCGAGACCCATCAAAGTGGAGAGCCCTCCCTTGGAAGAGTGGCC
CTCCCCGGCCCCATCTTTCAAAGAGGAATCATCTCACTCCTGGGAGGATTCGTCCCAATC
TCCCACCCCAAGACCCAAGAAGTCCTACAGTGGGCTTAGGTCCCCAACCCGGTGTGTCTC
GGAAATGCTTGTGATTCAACACAGGGAGAGGAGGGAGAGGAGCCGGTCTCGGAGGAAACA
GCATCTACTGCCTCCCTGTGTGGATGAGCCGGAGCTGCTCTTCTCAGAGGGGCCCAGTAC
TTCCCGCTGGGCCGCAGAGCTCCCGTTCCCAGCAGACTCCTCTGACCCTGCCTCCCAGCT
CAGCTACTCCCAGGAAGTGGGAGGACCTTTTAAGACACCCATTAAGGAAACGCTGCCCAT
CTCCTCCACCCCGAGCAAATCTGTCCTCCCCAGAACCCCTGAATCCTGGAGGCTCACGCC
CCCAGCCAAAGTAGGGGGACTGGATTTCAGCCCAGTACAAACCTCCCAGGGTGCCTCTGA
CCCCTTGCCTGACCCCCTGGGGCTGATGGATCTCAGCACCACTCCCTTGCAAAGTGCTCC
CCCCCTTGAATCACCGCAAAGGCTCCTCAGTTCAGAACCCTTAGACCTCATCTCCGTCCC
CTTTGGCAACTCTTCTCCCTCAGATATAGACGTCCCCAAGCCAGGCTCCCCGGAGCCACA
GGTTTCTGGCCTTGCAGCCAATCGTTCTCTGACAGAAGGCCTGGTCCTGGACACAATGAA
TGACAGCCTCAGCAAGATCCTGCTGGACATCAGCTTTCCTGGCCTGGACGAGGACCCACT
GGGCCCTGACAACATCAACTGGTCCCAGTTTATTCCTGAGCTACAGTAGAGCCCTGCCCT
TGCCCCTGTGCTCAAGCTGTCCACCATCCCGGGCACTCCAAGGCTCAGTGCACCCCAAGC
CTCTGAGTGAGGACAGCAGGCAGGGACTGTTCTGCTCCTCATAGCTCCCTGCTGCCTGAT
TATGCAAAAGTAGCAGTCACACCCTAGCCACTGCTGGGACCTTGTGTTCCCCAAGAGTAT
CTGATTCCTCTGCTGTCCCTGCCAGGAGCTGAAGGGTGGGAACAACAAAGGCAATGGTGA
AAAGAGATTAGGAACCCCCCAGCCTGTTTCCATTCTCTGCCCAGCAGTCTCTTACCTTCC
CTGATCTTTGCAGGGTGGTCCGTGTAAATAGTATAAATTCTCCAAATTATCCTCTAATTA
TAAATGTAAGCTTATTTCCTTAGATCATTATCCAGAGACTGCCAGAAGGTGGGTAGGATG
ACCTGGGGTTTCAATTGACTTCTGTTCCTTGCTTTTAGTTTTGATAGAAGGGAAGACCTG
CAGTGCACGGTTTCTTCCAGGCTGAGGTACCTGGATCTTGGGTTCTTCACTGCAGGGACC
CAGACAAGTGGATCTGCTTGCCAGAGTCCTTTTTGCCCCTCCCTGCCACCTCCCCGTGTT
TCCAAGTCAGCTTTCCTGCAAGAAGAAATCCTGGTTAAAAAAGTCTTTTGTATTGGGTCA
GGAGTTGAATTTGGGGTGGGAGGATGGATGCAACTGAAGCAGAGTGTGGGTGCCCAGATG
TGCGCTATTAGATGTTTCTCTGATAATGTCCCCAATCATACCAGGGAGACTGGCATTGAC
GAGAACTCAGGTGGAGGCTTGAGAAGGCCGAAAGGGCCCCTGACCTGCCTGGCTTCCTTA
GCTTGCCCCTCAGCTTTGCAAAGAGCCACCCTAGGCCCCAGCTGACCGCATGGGTGTGAG
CCAGCTTGAGAACACTAACTACTCAATAAAAGCGAAGGTGGACATGAAAAAAAAAAAAAA
AAAAA

Protein Sequence

>2305 : length: 801
MKTSPRRPLILKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPA
GIKIINHPTMPNTQVVAIPNNANIHSIITALTAKGKESGSSGPNKFILISCGGAPTQPPG
LRPQTQTSYDAKRTEVTLETLGPKPAARDVNLPRPPGALCEQKRETCADGEAAGCTINNS
LSNIQWLRKMSSDGLGSRSIKQEMEEKENCHLEQRQVKVEEPSRPSASWQNSVSERPPYS
YMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETS
ANGKVSFWTIHPSANRYLTLDQVFKPLDPGSPQLPEHLESQQKRPNPELRRNMTIKTELP
LGARRKMKPLLPRVSSYLVPIQFPVNQSLVLQPSVKVPLPLAASLMSSELARHSKRVRIA
PKVFGEQVVFGYMSKFFSGDLRDFGTPITSLFNFIFLCLSVLLAEEGIAPLSSAGPGKEE
KLLFGEGFSPLLPVQTIKEEEIQPGEEMPHLARPIKVESPPLEEWPSPAPSFKEESSHSW
EDSSQSPTPRPKKSYSGLRSPTRCVSEMLVIQHRERRERSRSRRKQHLLPPCVDEPELLF
SEGPSTSRWAAELPFPADSSDPASQLSYSQEVGGPFKTPIKETLPISSTPSKSVLPRTPE
SWRLTPPAKVGGLDFSPVQTSQGASDPLPDPLGLMDLSTTPLQSAPPLESPQRLLSSEPL
DLISVPFGNSSPSDIDVPKPGSPEPQVSGLAANRSLTEGLVLDTMNDSLSKILLDISFPG
LDEDPLGPDNINWSQFIPELQ