ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

22992

Name

KDM2A

Synonym

CXXC8|FBL11|FBL7|FBXL11|JHDM1A|LILINA;lysine (K)-specific demethylase 2A;KDM2A;lysine (K)-specific demethylase 2A

Definition

CXXC-type zinc finger protein 8|F-box and leucine-rich repeat protein 11|F-box/LRR-repeat protein 11|[Histone-H3]-lysine-36 demethylase 1A|jmjC domain-containing histone demethylation protein 1A|jumonji C domain-containing histone demethylase 1A|lysine-sp

Position

11q13.2

Gene Type

protein-coding

External Links

Links to cell senescence gene database

22992

Links to epithelial mesenchymal transition gene database

22992

Links to ovarian cancer gene database

22992

Links to endometrial cancer gene database

22992

Links to iHOP

22992

Sequence Information

Nucleotide Sequence

>22992 : length: 7393
GAGTCTGACGGGTTCAAAATGGCGGCGGCTGCTTCAGCGGCTCCTCCTGTGTGAGGGAAA
CAACACCCCTCCCCGGCAGCGGCGGCGGCGGCGGCGGCTCTCGGAGCACCTTCCCAGCGG
CTGGGCCCGTGGCCGCTCTGTCTTTCCTGGGCAGGGGACGCTCCGGGAGGAGGGGCAACG
CCAGGGGGCCCATCCCCCGGAATCCCTCTTCTGCGACTGGGGAGTAGCCGGGGGGCTCGT
CCCGCAGCGCGGAGCCAGACCTGAGGGGGAGACGCGAGGGGAGCCAGGGCCCCCATCCCG
GCGCGCCGCGCCGCTCCCGCCCTGTCCGCCCCCCGGGGCCGGGGCCCGCGTTCCGGGGGG
CCGGGGCGGCGCGGGGAGCCTCGGGCCGGCCGGTCTCAGCTGATCGGCCGCTGCTCCCGC
AGGCGACCAGCCCCTGCTGGCCGAGGGCACGGCGAGGAGGGCGCTCCCTGCGGCCGGGGC
CGGCCCGGGGCTCGGGCCCGGGCTGCTGACCGCTGGCCTGGGGGAGGCGGGGGCGCCCCG
GGCTCGGCGCCGAGGGGTCGCGCTCCTCTCTCCTGACGCCTCCGACTCCCGGTCTCCAAA
GCCAGAAGAGAAGGTTTGATTCAGCAACTGTTTGCTCCCTTTTCCTGGTCGCTCTGACCC
TCTCTGGATACTGGGTTGATCCACGGAAAAACCGAAGACGACGTTTGGGATTTAATTATT
CCTCTCAGCTTTGGAATCTTTTACTTCTCACTTGGACAAGAACTCAAGAGCAGAATCTCC
GTGTTGCAATCTGGTTCCTAAGGAGGAAGAGGAAGGCAGCCCTGGAGTGGTTTCTTTACA
GTAATTTCAACAGAAGAGTGAGAGATGGAACCCGAAGAAGAAAGGATTCGTTACAGCCAG
AGATTGCGTGGTACCATGCGACGACGCTATGAAGATGATGGCATTTCAGATGATGAAATT
GAAGGAAAAAGAACTTTTGACTTGGAAGAGAAACTGCACACCAACAAATATAATGCCAAT
TTTGTTACTTTTATGGAAGGAAAAGATTTTAATGTAGAGTATATTCAGCGGGGTGGCTTG
AGAGATCCTCTGATTTTCAAGAATTCTGATGGACTCGGAATAAAAATGCCGGATCCAGAC
TTCACTGTGAATGATGTCAAAATGTGTGTGGGGAGTCGTCGCATGGTGGATGTCATGGAC
GTGAACACACAGAAAGGCATTGAAATGACCATGGCTCAGTGGACACGCTACTATGAGACC
CCAGAGGAGGAGCGAGAGAAACTCTATAATGTCATCAGCCTCGAGTTTAGCCACACCAGG
CTGGAGAATATGGTGCAGAGGCCCTCCACGGTGGATTTCATTGACTGGGTAGACAACATG
TGGCCAAGGCACTTGAAGGAAAGCCAGACTGAATCAACAAATGCCATCTTGGAGATGCAG
TACCCTAAAGTGCAGAAGTACTGTCTAATGAGTGTTCGAGGCTGCTATACTGACTTCCAT
GTGGACTTTGGTGGTACCTCTGTTTGGTATCACATCCATCAAGGGGGAAAGGTCTTCTGG
CTCATCCCCCCTACAGCCCACAACCTGGAGCTGTACGAGAATTGGCTGCTGTCAGGGAAA
CAGGGAGACATCTTTCTGGGTGACCGGGTATCAGATTGTCAGCGCATTGAGCTCAAGCAG
GGCTATACCTTCGTCATTCCCTCAGGCTGGATTCATGCTGTGTATACTCCTACAGACACA
TTAGTGTTTGGGGGCAATTTTTTGCATAGCTTCAACATCCCTATGCAGTTAAAAATATAC
AACATTGAAGATCGGACACGGGTTCCAAATAAGTTTCGCTATCCATTCTACTATGAGATG
TGTTGGTATGTGTTGGAGCGCTATGTGTACTGCATAACCAACCGTTCCCACCTAACTAAG
GAATTTCAGAAAGAGTCCCTCAGCATGGATTTGGAGTTAAATGGGTTGGAGTCTGGGAAT
GGGGATGAGGAAGCAGTGGATCGAGAACCCCGACGCTTGAGCAGCAGGCGTTCTGTCCTC
ACTAGCCCTGTAGCGAATGGAGTCAACCTGGATTATGATGGACTGGGCAAAACCTGCCGA
AGTCTTCCAAGTCTGAAGAAAACTTTGGCTGGGGACTCATCTTCTGACTGTAGCCGGGGC
TCCCACAATGGACAAGTGTGGGATCCCCAGTGTGCTCCCCGAAAGGACAGGCAAGTGCAT
CTGACCCATTTTGAGCTTGAAGGCCTTCGCTGCCTTGTAGATAAGTTGGAGTCTCTGCCA
CTGCACAAGAAATGTGTCCCCACAGGGATAGAAGATGAAGATGCTCTCATTGCTGATGTA
AAGATTTTGCTGGAGGAGCTTGCCAACAGCGATCCCAAGTTAGCCCTCACTGGAGTTCCT
ATAGTACAGTGGCCAAAAAGGGATAAGCTTAAATTCCCCACTCGGCCAAAGGTGCGGGTT
CCTACCATCCCCATTACGAAGCCTCACACTATGAAACCAGCTCCACGGTTAACACCTGTG
AGGCCAGCTGCTGCCTCCCCGATTGTGTCAGGAGCCAGACGGAGACGAGTGCGATGTCGA
AAATGCAAAGCCTGTGTGCAAGGAGAGTGTGGTGTTTGCCACTACTGCAGAGACATGAAG
AAGTTTGGGGGGCCTGGACGCATGAAGCAGTCCTGTGTCCTCCGACAGTGCTTGGCACCC
AGACTGCCTCACTCAGTCACATGTTCCCTCTGTGGAGAGGTGGATCAGAATGAAGAGACA
CAAGACTTTGAGAAGAAACTCATGGAATGCTGTATCTGCAATGAGATTGTTCATCCTGGC
TGCCTCCAGATGGACGGAGAGGGGTTGCTTAACGAAGAATTGCCAAATTGCTGGGAATGT
CCAAAGTGCTACCAGGAGGACAGCTCGGAGAAAGCCCAGAAGCGGAAAATGGAAGAGAGT
GACGAAGAAGCTGTGCAAGCCAAAGTCCTGCGGCCCCTGCGGAGCTGCGATGAGCCTCTC
ACGCCCCCGCCTCATTCACCCACTTCCATGCTGCAGCTCATCCATGACCCGGTTTCCCCC
CGGGGTATGGTGACTCGGTCATCCCCTGGGGCTGGCCCCAGCGACCACCACAGTGCCAGC
CGCGATGAGCGCTTCAAACGGCGGCAGTTGCTGCGGCTGCAGGCCACAGAGCGCACCATG
GTACGGGAAAAGGAGAACAATCCCAGCGGCAAAAAGGAGCTGTCTGAAGTTGAGAAAGCC
AAGATCCGGGGATCGTACCTCACTGTCACGCTACAGAGGCCCACCAAAGAGCTCCACGGG
ACATCCATTGTGCCCAAGCTGCAGGCCATCACGGCCTCCTCTGCCAACCTTCGCCATTCC
CCCCGTGTGCTAGTGCAGCACTGCCCAGCCCGAACCCCCCAGCGTGGGGATGAGGAGGGG
CTGGGGGGAGAGGAGGAGGAAGAGGAGGAGGAGGAGGAGGAAGATGACAGTGCAGAGGAG
GGGGGTGCAGCCAGGCTGAATGGCCGGGGCAGTTGGGCTCAGGATGGAGACGAAAGCTGG
ATGCAGCGGGAGGTCTGGATGTCTGTCTTCCGCTACCTCAGCCGCAGAGAACTTTGTGAA
TGTATGCGAGTGTGCAAGACGTGGTATAAATGGTGCTGCGACAAGAGACTTTGGACAAAA
ATTGACTTGAGTAGGTGTAAGGCCATTGTGCCCCAGGCCCTCAGTGGCATCATCAAGAGG
CAGCCAGTCAGCCTTGACCTCAGTTGGACCAACATCTCTAAAAAGCAACTGACATGGCTC
GTCAATAGGCTGCCAGGACTGAAAGACCTCCTCCTAGCAGGCTGCTCCTGGTCTGCAGTC
TCTGCCCTCAGCACCTCCAGCTGCCCCCTTCTCAGGACCCTTGATCTTCGGTGGGCAGTA
GGAATCAAGGACCCTCAAATTCGGGACTTGCTTACTCCACCGGCTGATAAACCAGGTCAG
GACAATCGCAGCAAGCTCCGGAACATGACCGACTTCCGGCTGGCAGGCCTTGACATCACA
GATGCCACGCTTCGCCTCATAATTCGCCACATGCCCCTCCTGTCTCGACTCGACCTCAGT
CACTGCAGCCACCTTACAGATCAGTCCTCCAATCTACTCACTGCTGTCGGGTCTTCCACT
CGCTACTCTCTCACAGAGCTCAATATGGCAGGTTGCAATAAATTGACAGACCAGACCCTG
ATCTACCTACGGCGCATTGCCAACGTCACCTTGATCGACCTTCGAGGATGCAAGCAGATC
ACTCGAAAAGCCTGCGAGCACTTCATCTCAGACTTGTCCATCAACAGCCTCTACTGCCTG
TCTGACGAGAAGCTGATACAGAAGATCAGCTAAGACACACCCAGCCCAGATTCAACAGGA
AACCGATCTTCCCCTGACTCCCCACCGAGGAGAGCCTCTCCTCGACCCTGCACGGGCTCT
GAGGCCAGCGTCACACTCCCTCTCTGCTCTCCTGTCCCTTGAGCCCTTCCTCTACAGGTG
GGGCAGAGAGGGTGGTGGACACCAGGCTTATCTGCCTGCTCCTCTCCCTCCTAAGGAAAA
GGGAGTAGCAGATTGATCTGAGGGGAAAGCACAGGCTGTGCTGTCGAGGCGCCTGCTCGC
TTACTCGCCTGCCAGGAGGCCGGGCTCTCAGTTTGGGGTGTTTGTGCAACCTTCATCTGC
ACTGGGCCCTGTGCCCCTCCTCCCCATCCATGGTCCCCAGCAGTGCCTGGTTCTGAGCAA
ACTCCCAGGGAAGAAAACGGCCCTGTCTCCATGGCCAGGTTCTTGTGGTGTCCAGTGCGC
GTCTCTCCTCCATCACACTCTCCCGGCTTGCGCAGGAGGGGCCAGCAGCCCCAGGAGTCC
CAGACCCGTGCCGATCACACTGGTGCTGTTGAGATCTCCCAAACCTCACGTCCTTAACTG
TGCTCTCCCTCCTTTCCTCTCCCTTGAGCTTGGTTCTGCCCAGCACTCGTGCTTGTTCAC
ATAATTAGGTTTCCCACCCCAGCCTACCCGACTTACTTGCTAGTCTCTATGAGGTCCTTA
TTGCACTTATTGGGGTTGAAGCTCTTCAGAGGAGCTGGAACTGTCTACCCCAGGGACACA
CCCATTTCGTTGCTACCCAAGTGGATTCTGAGACAGGCACCATCTCCTTGTTCCCCCTCT
CTCTTTTGCCTCCCACTGACTGCCCTTTTCCATGTGTCTTCATTCTGCCTGAAGAAGGCT
TTCCCAGGATGCACGTCCTCAGAGGGAGCAGCCTATCTCCCCCAAGCTGGAGGCGGCAGA
GGACTGGGCCAAGCCCCAACCTGCCTCCCAGCCAGGCTCCTCCAGGCCTCTGGTTTAGCG
GAGCCCCCTGAGCCCAGGCCTGTGTCTAGCCCCAGTGGCTCACTGAACTTTCAGGGCAGT
CAGGGGGTCCTGCTTAGAAGCCAGTCACCAGCCCTCTGCCTGCAGCCATGGAAGGGGGTG
TGCACGTGCCTCTGTGTGTGTGGCTGAGTGTATTCTGCGCGTGTGTGTGGAGGGAGGGAG
GGAGGGGAGCATGGTGTCTCCCGCTCCACCGCCCTTTGTTGAGCCCCATCAGCTGCCCCC
TTTTACTTTGCATTGAACGGCCTGTCCAAAGATCCTCTCTCTAGGGCAGCAGAGAGCTTT
TTGCACTTTAAAAAAAAAAAGAAAGAAAGAAAGGTCGGAATTTCTTTTGGGTCAATATTT
TTAAGTGTGTGAGGAGATGCTCAGTAGCAGCAGCCTATGGCAAGAGCTTATAAATGATTG
ATGCAAATTTGCACTCTGCTCCCCCTCTGTAAGGATACTGATAGCACAACCTCTTCCCCC
CACCCCGCCCCGCCTTTTGGTCGTCCATCCCTGTCCCTTTCTGGCCCTCTTCCTGTAGCC
CAGTCTCAGGCTTTCCTCTTCCTGAAGCCCTACAGAGTTAGGGAATGGAGCCCAGGCACC
AGGGGTCTAAAGTGTGAGCCACTGAGAAGAGAGACGCCAACTGCACCCTTGCCACTTCCA
AAGCAATAGAGGCAGAGTGGTCCCCTCTTTGCCACCTAGGCCAGTTTTGACCCTGGCATT
AACTGGCCTTAGAAGAAACTGGATCCTGGTAGGGGGTGGCATTTTGTTTGTTTCTTCCAA
TCTGCTGAATCTTTTGACTGCACCTTACAAACAGCAGTCTGCTCCCATGACCCTCTGCCC
ACTTCCATTGGTCTCCAGGCCCCAATAATCTGGGGTTGAAACTTTGAGGAAATGCCAGTG
ACTTATTCCAGAGTGCCTCAGTTAGGGGAACTTCTCTGTAAAGAACCCTGGGTATTGAGC
AAAAACCTTATTATCGTTAATGACCTATAATTGGAAGCTTCCTGCCTTTTTCTTTGGTTG
CTCCTGTGGAAAATACTGAAAAGATTACTTTGTTTTATTTTGTTGTCTTTTTATAAAAGG
GGAGGTGGAGAGACCCCTTCAGAGCAGGGATTGTGCCGGGAGAGTGCCTCTGACTTTGGG
ACATTTCATCCACAGAAATTTCCAAGCCAATGGTTTCTTTTGGGTTTTGGTTTTTATGTT
TGTTTTTTGGGGTTTGGAAAAACATGCATTTTTACCGTGCACGTAAATTGGTCAGCAGAA
AAGGGAGCCCAGAAAAGGCAGCAGATGGACCATGCCCTTGCTGGGTTTTCCTTTTCTTTG
GGACTGTGAGGGGAAATGGTTTTTAGAGGTGAGGGTTGGTCCATGTGGAGGAAAGAAGTG
TCTCTGTTGGGGGACAGAGGAACCTGGGGAGTCCATCGCATGTCCTACAATCTGCTCTTA
GACACGGCCTTGCCAGGAGAGCCTGCCCTCAGACTGCAGGACCAGAACCCCTGCCTCCAT
CTTTCCAAGCACCGGGGCGAAAAACCACAAAGGAAAGGAAGAAAATTTATATATATATAA
TATAAAATCACTTGGTGATTAAAAAAATAACTGCTCCATAAATAAAACTCCTAAAGTCAC
TTATGTTTAAAGGGTTTGGTTGTGTTTTTTGTTTTTCGGAGAAATATTGTAAATATATAT
TTTTTTGTTGCTGATTTAGAGTCAATCTCCAATGTTGTGCTAAAAAGTTTAAATTAAATG
TAAGCATTAAGGGGATAAGTCTTATGCTATCTCAGTTGACACATTGAGGTTATTTTGGGC
CAGAGAAGGAGGAAGCTAGTTGGACTTTGTTTTGTTTTCCAAAAGTTCTCCACTATTGGT
TTTAGAGAGAGCAAGGACATCTTTCCTCTGACACGTGGGAATGGGTGATATTTGTGTAAT
AAAATTTTTAAAAGACAAAAAAAGAAATAGCCTCCAATGGGAAATATTTTAATTTAGGTT
TTGTTTTTGTTTGGGGGTTTTTGTTTTTTTAAAAAAATAAAAAGGCTTTAAAAACAAAAA
AAAAAAAAAAAAA

Protein Sequence

>22992 : length: 1162
MEPEEERIRYSQRLRGTMRRRYEDDGISDDEIEGKRTFDLEEKLHTNKYNANFVTFMEGK
DFNVEYIQRGGLRDPLIFKNSDGLGIKMPDPDFTVNDVKMCVGSRRMVDVMDVNTQKGIE
MTMAQWTRYYETPEEEREKLYNVISLEFSHTRLENMVQRPSTVDFIDWVDNMWPRHLKES
QTESTNAILEMQYPKVQKYCLMSVRGCYTDFHVDFGGTSVWYHIHQGGKVFWLIPPTAHN
LELYENWLLSGKQGDIFLGDRVSDCQRIELKQGYTFVIPSGWIHAVYTPTDTLVFGGNFL
HSFNIPMQLKIYNIEDRTRVPNKFRYPFYYEMCWYVLERYVYCITNRSHLTKEFQKESLS
MDLELNGLESGNGDEEAVDREPRRLSSRRSVLTSPVANGVNLDYDGLGKTCRSLPSLKKT
LAGDSSSDCSRGSHNGQVWDPQCAPRKDRQVHLTHFELEGLRCLVDKLESLPLHKKCVPT
GIEDEDALIADVKILLEELANSDPKLALTGVPIVQWPKRDKLKFPTRPKVRVPTIPITKP
HTMKPAPRLTPVRPAAASPIVSGARRRRVRCRKCKACVQGECGVCHYCRDMKKFGGPGRM
KQSCVLRQCLAPRLPHSVTCSLCGEVDQNEETQDFEKKLMECCICNEIVHPGCLQMDGEG
LLNEELPNCWECPKCYQEDSSEKAQKRKMEESDEEAVQAKVLRPLRSCDEPLTPPPHSPT
SMLQLIHDPVSPRGMVTRSSPGAGPSDHHSASRDERFKRRQLLRLQATERTMVREKENNP
SGKKELSEVEKAKIRGSYLTVTLQRPTKELHGTSIVPKLQAITASSANLRHSPRVLVQHC
PARTPQRGDEEGLGGEEEEEEEEEEEDDSAEEGGAARLNGRGSWAQDGDESWMQREVWMS
VFRYLSRRELCECMRVCKTWYKWCCDKRLWTKIDLSRCKAIVPQALSGIIKRQPVSLDLS
WTNISKKQLTWLVNRLPGLKDLLLAGCSWSAVSALSTSSCPLLRTLDLRWAVGIKDPQIR
DLLTPPADKPGQDNRSKLRNMTDFRLAGLDITDATLRLIIRHMPLLSRLDLSHCSHLTDQ
SSNLLTAVGSSTRYSLTELNMAGCNKLTDQTLIYLRRIANVTLIDLRGCKQITRKACEHF
ISDLSINSLYCLSDEKLIQKIS