ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

22981

Name

NINL

Synonym

NLP|dJ691N24.1;ninein-like;NINL;ninein-like

Definition

ninein-like protein

Position

20p11.22-p11.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

Pathway

Loss of Nlp from mitotic centrosomes;PID Reactome;500384

Pathway

PLK1 signaling events;PID Curated;200087

Pathway

PDGF signaling pathway;PANTHER;P00047

Pathway

Loss of proteins required for interphase microtubule organization from the centrosome;PID Reactome;500383

External Links

Links to cell senescence gene database

22981

Links to epithelial mesenchymal transition gene database

22981

Links to ovarian cancer gene database

22981

Links to endometrial cancer gene database

22981

Links to iHOP

22981

Sequence Information

Nucleotide Sequence

>22981 : length: 5642
GTTGTGATGATGACGATTTCTGTTGGGCACCACTGTTACAGCAGTTACTGATGATCTCAG
AGTGAGCCCGGACTCTCCTGGAGCCCCTGCCTGGCTGGTTGAGCTGTTCTCCCCCATGGC
GCCCACTTACCCCAGGCCCTTCCCACCATGGGCCAGGTGTCAGGAGGTGCACCCTTCCCT
CCGTGTTCTGCTGGGGCTGCCTGGGAGGGAAGATGTGGTCCTTGCATGGGACACAGCTCC
TTACAGGCTCAGGCTTCCCAGAGGGATGCAGGCCAGCCCTGGAGATTTGGAAGGAGCTCT
GCCCTGGGCACAATTTGGCAACAACTGTGCAGGGGCAGAGGTGTGCAGGGGCCCAGCATG
GATGATGGAAGACAGCCTCACGAGGTGCAGTGAACTCAACTGAACAAAAACCTATTAAAT
AAGAAAGAAAGCCTACCTGCCCCCCTCTCCCTATTCCCTGGAGGGGGCGACAGCTGTTGG
TGTAGTGGGTGTACTGCAGAGCTTTTCCCTGGCACATGAGAGATGTATATATACATTCTG
GCTAAATTTTTTTTTTTTTTTTTTTTTTTTTTGCGAAATTGGTGTCATACTGTTTGTCTT
GCTAATTTGTGCGACCCTTCGCTTTTCCTATGATAAATCTGGGCATTTATAATGCAACGA
TGTCCTCTTGCTGCTGTGCCAGCATTTCTCTGAGGCTGGACTCCTGAAGTTGCACCCTGT
AACTCTTGGAGGCTCTGTCATATTCCCTCAGAAAATGTCCTGTTGGCACAGATAGACAAT
ACAGGAAGGAGCCCAGACAGCCCTTGAAACAGTCCACCCTACTCCACAGACCAAGACCCT
CATTGGCGCAACCTCATCTGTTACCGAGTCCCCCAAGATGGCAAAGCCAGACCTGGACAG
CTGGCCTCACAATTGTCCTGAGAGCCAGAGGCGGAGGCAGGATCACCAAAAATCGCTTGC
AGGAAGGGCAGAGAGCACAAGTCTCTCGGTTCCAAGATGCCCGACACCTGACTCCACAGC
CCTGGGGGTGCCCTGGCTGCTGCTGTGCGCTGGCTCTGATGAGTGCATGTTGCCTCTGCC
CTTTCAGAACTTATTCTCTTTCCCATTTGCGCTAGAGCTGCTGGTGCTGCTCTGCAAAGA
CGCCCTGGGTGGCTTCTCCCTCGCTTCATGATAGATTATTGCCAAATTCTGCCTTGCAAC
TCAGTCAGCATTTCTGACCTCAGGCTGCTGTGGCGGTTCTGTCCCTCTACGCCATCCAGT
GACGTGGTGGGGAGCGTGTGCTTGTGTAGGGACAGCTTTCCAGGCGGCTCCCCAGCCTCT
CCCAAGATGCCATTGCTCCTCAGGAGCTGCTGGGAAGTGGGCAGTGTGGAAAGTCAGCCC
CTACTTCACAGGAGACTCTGGGCCAGGCACGTCCTGGCACCTGCTTCAGCCGCCCTGCCA
TGGTGCCTGCCGCCGGCCTGAGCAGGGCGTTTGTAGCCACAAGTGGAAAGCAGAGCCAGG
AATACCCAAGGCGGAAAAAGCAAACACGACAGAACGTTAGCTGCCGCTCCCTTGAGCTGA
GGGTCTTAGGAGCCTGGACTTCAGCGTGGACGAGAAGGTGAACCTTCTGGAGCTGACCTG
GGCCCTTGACAACGAGCTCATGACAGTGGACAGTGCCGTCCAGCAGGCAGCCCTGGCCTG
CTACCACCAGGAGCTGAGCTACCAGCAAGGGCAGGTGGAGCAGCTGGCAAGGGAGCGTGA
CAAGGCAAGGCAGGACCTGGAGAGGGCCGAGAAGAGGAACCTGGAGTTTGTGAAAGAGAT
GGACGACTGCCACTCCACCCTGGAGCAGCTCACGGAGAAGAAAATCAAGCATCTGGAGCA
GGGGTACCGGGAAAGGCTGAGCCTCCTGCGGTCTGAGGTGGAGGCGGAGCGAGAGCTGTT
CTGGGAGCAGGCCCACAGGCAGAGGGCCGCGCTGGAGTGGGACGTGGGGCGCCTGCAGGC
TGAGGAGGCTGGCCTCCGCGAGAAGCTGACCCTGGCCCTGAAGGAAAACAGTCGCCTACA
GAAGGAGATTGTGGAAGTGGTGGAAAAGCTTTCGGATTCGGAGAGGCTGGCCCTGAAGCT
GCAGAAGGACCTGGAGTTTGTGCTGAAGGACAAGCTGGAGCCACAGAGTGCAGAGCTCCT
GGCCCAGGAGGAGCGGTTCGCAGCAGTCCTGAAGGAATACGAGCTCAAGTGCCGGGACCT
GCAGGACCGCAACGATGAGCTGCAAGCTGAGCTGGAAGGCCTGTGGGCGCGGCTGCCCAA
GAACCGGCACAGCCCCTCATGGAGCCCGGATGGGCGCAGACGGCAGCTCCCTGGACTCGG
CCCAGCAGGCATTTCATTCCTGGGTAATTCTGCTCCAGTGAGTATAGAAACGGAGCTGAT
GATGGAGCAGGTAAAGGAGCATTACCAAGACCTCAGGACCCAGCTGGAGACCAAGGTAAA
TTACTACGAAAGGGAAATTGCGGCACTGAAAAGGAACTTTGAGAAGGAGAGGAAGGACAT
GGAGCAGGCTCGCAGGCGCGAGGTCAGCGTGCTGGAGGGTCAGAAGGCCGACCTGGAGGA
GCTCCACGAGAAGTCTCAGGAGGTCATCTGGGGCCTGCAGGAGCAGCTGCAGGACACAGC
CCGCGGCCCCGAGCCTGAGCAGATGGGCCTGGCACCCTGCTGCACCCAGGCACTGTGTGG
CCTGGCCCTGCGGCATCACAGCCACCTGCAGCAGATCAGGAGAGGAAGTGCCTGGTCATC
GCAGACAGGCTGCTGCTCAGCTGGCACCCACTGTCCTGTGGAGAGCATTGGCCCCGGCTT
AGAAGAGGACGGGCCCTCCCACCACACTGGCCAGGCCACCCCCAGCCTGACAGAAAGTCA
TCTTTCCGGCCGGATGCGGTGGCTCACACCTGTAATCAGCACTTTGGGAGGCCAAGGCGG
GAGAGAGGCTGAGGCGGAGCTGAGTGGAGAGCTGTCGGGGCTGGGAGCCCTGCCCGCTCG
CAGAGACCTGACCTTGGAGCTGGAGGAGCCGCCGCAGGGACCCCTGCCACGCGGGAGCCA
GAGGTCGGAGCAGCTGGAGCTGGAGAGGGCACTGAAGCTGCAGCCCTGTGCGAGCGAGAA
GCGCGCCCAGATGTGCGTATCGTTGGCCCTCGAGGAGGAGGAGTTGGAGCTTGCCCGCGG
GAAGCGAGTGGACGGGCCCTCCCTGGAAGCAGAGATGCAGGCCCTGCCGAAAGATGGGCT
GGTGGCAGGAAGTGGCCAGGAGGGCACACGTGGCCTCCTACCACTGCGTCCGGGCTGTGG
GGAGCGGCCACTGGCCTGGCTGGCCCCAGGTGATGGCAGAGAGTCTGAGGAGGCGGCAGG
AGCCGGGCCTCGCCGCAGGCAAGCCCAGGACACAGAAGCTACGCAGAGCCCGGCCCCCGC
CCCTGCCCCGGCATCCCACGGCCCCTCAGAGAGGTGGTCACGCATGCAGCCCTGTGGAGT
GGATGGGGATATTGTCCCAAAGGAGCCAGAGCCTTTCGGCGCGAGCGCAGCGGGGCTGGA
GCAGCCTGGAGCCCGGGAGCTGCCTCTGCTGGGAACAGAGAGAGACGCCTCGCAAACCCA
GCCACGGATGTGGGAGCCACCCCTGAGGCCGGCCGCTTCGTGCAGGGGACAGGCTGAGAG
GCTACAGGCCATTCAGGAAGAGCGAGCACGAAGCTGGAGCAGGGGCACCCAGGAGCAGGC
CTCGGAGCAGCAGGCCCGGGCCGAGGGCGCCCTGGAGCCTGGGTGTCACAAGCACAGTGT
GGAGGTTGCCAGGAGAGGGTCCTTGCCATCCCACCTCCAGCTCGCAGACCCGCAGGGTTC
CTGGCAGGAGCAGCTTGCTGCCCCAGAAGAGGGGGAGACCAAAATAGCGCTGGAGAGAGA
GAAGGATGACATGGAAACCAAACTTCTACATCTGGAAGACGTCGTCCGGGCTCTGGAGAA
ACATGTAGATTTGAGAGAGAACGACAGACTGGAGTTCCATAGACTTTCTGAAGAAAACAC
TTTGTTGAAAAACGATCTGGGAAGGGTTCGGCAAGAGCTTGAAGCTGCAGAAAGTACTCA
CGATGCACAGAGGAAGGAAATTGAGGTTTTAAAGAAAGACAAGGAAAAGGCCTGCTCTGA
GATGGAGGTGCTCAACAGACAGAATCAGAACTACAAGGATCAATTATCCCAGCTCAATGT
CAGGGTTCTTCAACTGGGACAGGAGGCTTCTACCCACCAGGCCCAAAACGAGGAGCATCG
TGTGACCATTCAGATGTTAACACAGAGCCTGGAGGAGGTGGTTCGCAGTGGGCAGCAGCA
GAGTGACCAAATCCAAAAACTTAGAGTTGAACTTGAATGCCTGAATCAGGAACATCAGAG
CCTGCAGCTGCCATGGTCAGAGCTGACCCAGACCCTTGAGGAAAGTCAAGACCAGGTGCA
GGGAGCTCACCTGAGGCTGAGGCAGGCCCAGGCCCAGCACTTGCAGGAGGTCCGGCTGGT
GCCCCAGGACCGTGTGGCCGAGCTGCATCGCCTGCTCAGCCTTCAGGGAGAGCAGGCCAG
GAGGCGCCTGGATGCACAGCGGGAAGAACATGAGAAACAGCTGAAAGCCACAGAAGAGCG
GGTGGAAGAGGCGGAGATGATTCTGAAGAATATGGAAATGCTCCTCCAAGAGAAAGTGGA
TAAGCTGAAGGAGCAGTTTGAAAAGAACACGAAGTCCGACCTGCTGCTGAAGGAGCTGTA
CGTGGAGAACGCCCACCTGGTGAGAGCACTTCAGGCCACCGAGGAGAAGCAGCGAGGCGC
CGAGAAACAAAGCCGCCTCTTGGAAGAAAAAGTTCGCGCTCTCAACAAACTCGTCAGTAG
GATTGCCCCCGCAGCCCTCTCTGTGTAAAGACAGATTATTTTCTAGGATTCATTCGAAAG
CACATCTTTTAAATTAAGCCACTGTGCTGCCTTAGATTCCGTGGGTCATGAGCCATGAGT
CCTGGGACATCTGAGGATTGGGATTCTTTGTTCACCCCGCAGATAGTTAATGAATGGTCT
GCCCTGGGCAAGATGGAGGTGGGGGCTGGGGGAATATGCATGTTGCAGAAGCCGGCGTTT
TTATTAGCGGTCCTGAGTAATTTCCCTTGGCAAAATTCCCAGTTTTGCCACTCTCTGGAG
CCAGATCCTGGGAGCTGTCAGCAAGGAGCAGGTAAGTGAGCAGTTATGGACAGCACTTTC
CATGTGGTGCTTCCGACCCTGGCTGTCAGAGTGAAATGTAAAGTCAGGGCTCTGTACAGT
TTTGCCATTTCACTGTTCTGCTTTAAGCTTAGCTTATTAGAACTCTTGGTGGAGGGTGCG
TACACACATTCCAGAAAAGGCTTCACTCGCTGGGAACGTCAACCCAGCGAGAAAGGAGGG
GAAGCCCCTTCTCCGGGGACCTTATCTGTGGACTCAGGAATGATGGTGTTTATTGCAAAT
GCACAATCTTTTTCCCATTGAAATGTCATCACACTGGAAATTGTACTATATGTAAAAAAA
AAAAAAAGTATAGTTTTATATTTGAAATGTATGCAAATTATGGCCATATGGCTGATTGGA
ATGTACTACTGTAATATAAAAAGTCACTGTATTTGCAATAAATTCTTTTCTATTAAAATT
GA

Protein Sequence

>22981 : length: 1470
MKKKLKRPLNCAACYGMDEEENHYVSQLREVYSSCDTTGTGFLDRQELTQLCLKLHLEQQ
LPVLLQTLLGNDHFARVNFEEFKEGFVAVLSSNAGVRPSDEDSSSLESAASSAIPPKYVN
GSKWYGRRSRPELCDAATEARRVPEQQTQASLKSHLWRSASLESVESPKSDEEAESTKEA
QNELFEAQGQLQTWDSEDFGSPQKSCSPSFDTPESQIRGVWEELGVGSSGHLSEQELAVV
CQSVGLQGLEKEELEDLFNKLDQDGDGKVSLEEFQLGLFSHEPALLLESSTRVKPSKAWS
HYQVPEESGCHTTTTSSLVSLCSSLRLFSSIDDGSGFAFPDQVLAMWTQEGIQNGREILQ
ACCFQSLDFSVDEKVNLLELTWALDNELMTVDSAVQQAALACYHQELSYQQGQVEQLARE
RDKARQDLERAEKRNLEFVKEMDDCHSTLEQLTEKKIKHLEQGYRERLSLLRSEVEAERE
LFWEQAHRQRAALEWDVGRLQAEEAGLREKLTLALKENSRLQKEIVEVVEKLSDSERLAL
KLQKDLEFVLKDKLEPQSAELLAQEERFAAVLKEYELKCRDLQDRNDELQAELEGLWARL
PKNRHSPSWSPDGRRRQLPGLGPAGISFLGNSAPVSIETELMMEQVKEHYQDLRTQLETK
VNYYEREIAALKRNFEKERKDMEQARRREVSVLEGQKADLEELHEKSQEVIWGLQEQLQD
TARGPEPEQMGLAPCCTQALCGLALRHHSHLQQIRRGSAWSSQTGCCSAGTHCPVESIGP
GLEEDGPSHHTGQATPSLTESHLSGRMRWLTPVISTLGGQGGREAEAELSGELSGLGALP
ARRDLTLELEEPPQGPLPRGSQRSEQLELERALKLQPCASEKRAQMCVSLALEEEELELA
RGKRVDGPSLEAEMQALPKDGLVAGSGQEGTRGLLPLRPGCGERPLAWLAPGDGRESEEA
AGAGPRRRQAQDTEATQSPAPAPAPASHGPSERWSRMQPCGVDGDIVPKEPEPFGASAAG
LEQPGARELPLLGTERDASQTQPRMWEPPLRPAASCRGQAERLQAIQEERARSWSRGTQE
QASEQQARAEGALEPGCHKHSVEVARRGSLPSHLQLADPQGSWQEQLAAPEEGETKIALE
REKDDMETKLLHLEDVVRALEKHVDLRENDRLEFHRLSEENTLLKNDLGRVRQELEAAES
THDAQRKEIEVLKKDKEKACSEMEVLNRQNQNYKDQLSQLNVRVLQLGQEASTHQAQNEE
HRVTIQMLTQSLEEVVRSGQQQSDQIQKLRVELECLNQEHQSLQLPWSELTQTLEESQDQ
VQGAHLRLRQAQAQHLQEVRLVPQDRVAELHRLLSLQGEQARRRLDAQREEHEKQLKATE
ERVEEAEMILKNMEMLLQEKVDKLKEQFEKNTKSDLLLKELYVENAHLVRALQATEEKQR
GAEKQSRLLEEKVRALNKLVSRIAPAALSV