ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

22954

Name

TRIM32

Synonym

BBS11|HT2A|LGMD2H|TATIP;tripartite motif containing 32;TRIM32;tripartite motif containing 32

Definition

72 kDa Tat-interacting protein|E3 ubiquitin-protein ligase TRIM32|TAT-interactive protein, 72-KD|tripartite motif-containing 32|tripartite motif-containing protein 32|zinc finger protein HT2A|zinc-finger protein HT2A

Position

9q33.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Ubiquitin mediated proteolysis;KEGG PATHWAY;hsa04120

Disease

Bardet-Biedl syndrome;KEGG DISEASE;H00418

Disease

Other genetic disorders;KEGG DISEASE

Disease

Muscular dystrophy, limb-girdle, type 2H;OMIM

Disease

Genetic disorders;KEGG DISEASE

Disease

Bardet-Biedl syndrome 11;OMIM

External Links

Links to cell senescence gene database

22954

Links to epithelial mesenchymal transition gene database

22954

Links to ovarian cancer gene database

22954

Links to endometrial cancer gene database

22954

Links to iHOP

22954

Sequence Information

Nucleotide Sequence

>22954 : length: 3803
ATACTACTTCCCTGGTGCTATACTAAGCACATCATATTTATCTTGTTACTTAGCCCTTAT
AATAACCATATAAGGCAGACACCATTATTACTTCTATTTTACAGATGAGTGATGGGGAAA
GAGCTTTTGGAAGTTTGAGTTAATTCCTTATGGTCATGCAGCTAACAGGAATTTGACCCT
CTAGGGCATGAATACTGTGCTGTTCAGTTCTGAGCTGTGCTAGCAATACCCTTCAAAGGA
AGAGCAATGGCTGCAGCAGCAGCTTCTCACCTGAACCTGGATGCCCTCCGGGAAGTGCTA
GAATGCCCCATCTGCATGGAGTCCTTCACAGAAGAGCAGCTGCGTCCCAAGCTTCTGCAC
TGTGGCCATACCATCTGCCGCCAGTGCCTGGAGAAGCTATTGGCCAGTAGCATCAATGGT
GTCCGCTGTCCCTTTTGCAGCAAGATTACCCGCATAACCAGCTTGACCCAGCTGACAGAC
AATCTGACAGTGCTAAAGATCATTGATACAGCTGGGCTCAGCGAGGCTGTGGGGCTGCTC
ATGTGTCGGTCCTGTGGGCGGCGTCTGCCCCGGCAATTCTGCCGGAGCTGTGGTTTGGTG
TTATGTGAGCCCTGCCGGGAGGCAGACCATCAGCCTCCTGGCCACTGTACACTCCCTGTC
AAAGAAGCAGCTGAGGAGCGGCGTCGGGACTTTGGAGAGAAGTTAACTCGTCTGCGGGAA
CTTATGGGGGAGCTGCAGCGGCGGAAGGCAGCCTTGGAAGGTGTCTCCAAGGACCTTCAG
GCAAGGTATAAAGCAGTTCTCCAGGAGTATGGGCATGAGGAGCGCAGGGTCCAGGATGAG
CTGGCTCGCTCTCGGAAGTTCTTCACAGGCTCTTTGGCTGAAGTTGAGAAGTCCAATAGT
CAAGTGGTAGAGGAGCAGAGTTACCTGCTTAACATTGCAGAGGTGCAGGCTGTGTCTCGC
TGTGACTACTTCCTGGCCAAGATCAAGCAGGCAGATGTAGCACTACTGGAGGAGACAGCT
GATGAGGAGGAGCCAGAGCTCACTGCCAGCTTGCCTCGGGAGCTCACCCTGCAAGATGTG
GAGCTCCTTAAGGTAGGTCATGTTGGCCCCCTCCAAATTGGACAAGCTGTTAAGAAGCCC
CGGACAGTTAACGTGGAAGATTCCTGGGCCATGGAGGCCACAGCGTCTGCTGCCTCTACC
TCTGTTACTTTTAGAGAGATGGACATGAGCCCGGAGGAAGTGGTTGCCAGCCCTAGGGCC
TCACCTGCTAAACAGCGGGGTCCTGAGGCAGCCTCCAATATCCAGCAGTGCCTCTTTCTC
AAGAAGATGGGGGCCAAAGGCAGCACTCCAGGAATGTTCAATCTTCCAGTCAGTCTCTAC
GTGACCAGTCAAGGTGAAGTACTAGTCGCTGACCGTGGTAACTATCGTATACAAGTCTTT
ACCCGCAAAGGCTTTTTGAAGGAAATCCGCCGCAGCCCCAGTGGCATTGATAGCTTTGTG
CTAAGCTTCCTTGGGGCAGATCTACCCAACCTCACTCCTCTCTCAGTGGCAATGAACTGC
CAGGGGCTGATTGGTGTGACTGACAGCTATGATAACTCCCTCAAGGTATATACCTTGGAT
GGCCACTGCGTGGCCTGTCACAGGAGCCAGCTGAGCAAACCATGGGGTATCACAGCCTTG
CCATCTGGCCAGTTTGTAGTAACCGATGTGGAAGGTGGAAAGCTTTGGTGTTTCACAGTT
GATCGAGGATCAGGGGTGGTCAAATACAGCTGCCTATGTAGTGCTGTGCGGCCCAAATTT
GTCACCTGTGATGCTGAGGGCACCGTCTACTTCACCCAGGGCTTAGGCCTCAATCTGGAG
AATCGGCAGAATGAGCACCACCTGGAGGGTGGCTTTTCCATTGGCTCTGTAGGCCCTGAT
GGGCAGCTGGGTCGCCAGATTAGCCACTTCTTCTCGGAGAATGAGGATTTCCGCTGCATT
GCTGGCATGTGTGTGGATGCTCGTGGTGATCTCATCGTGGCTGACAGTAGTCGCAAGGAA
ATTCTCCATTTTCCTAAGGGTGGGGGCTATAGTGTCCTTATTCGAGAGGGACTTACCTGT
CCGGTGGGCATAGCCCTAACTCCTAAGGGGCAGCTGCTGGTCTTGGACTGTTGGGATCAT
TGCATCAAGATCTACAGCTACCATCTGAGAAGATATTCCACCCCATAGGGGATGAGAAAT
TATCAGTTTCTTCTGCTCCCAAGCCAACTTCCCTTCCCTTAGTTCTTGGTTGTTAGTGGC
ACATGCAGAATAGACTCAGCCTATGTCCTGATTCCAGCTGGGTAGTTCTAGAACTTCAGA
AGCTCCATCTTTTAATGTTTTTATTTGTTATGTCCCCCTCCCCGCTTCCCACCTAAATTT
AGAGCTTTAAAAGATGCACTGCCCAAATAGGACACACGATGGTGTTAGCTGAAGTTTGAT
TAGCAATTAGGCACTTCCAAGGCTTTAGTAGAGAGAGCCACTTTAGCCCTTTGTGCCATG
TTTGAAATTTGCCCTTGTATTAAATCCTTGATTTTTTCCCATTTGGCTTTGATGCCCTTG
ATCCATTGTTTCCTTCCTACTATAATGTGCTTCATCTGTGACACTTTCTCTTGAACTCTG
ATTGGATTCACTGTGCATGCTTCAGTGGGATCTGCTCCACCTTTCAGTGACATTTAAGAC
ATCATATTCCCGTAACATTATGTCTCAGTCTGATCGTCTTTACCAGTATGAAAGTCATTC
ATTTAGTGCTACCAAAGGGGATACACAAGCCCTTTAGGAAGCAGTACCTCTCGCCTGGAG
GATCTGTGCCATCTTGGATTGAGAATTGCAGATGTGACAGAATGGATTGACCCTAGTTGG
TTGGTATTGATGACTTCAGCCTGGAAATTGCTTGCCTTTTAAAGAAGCATATATGGGTTG
GAATTATGCCAAAGCATAGGAAGCTGGGAATAAGCAAACAAATGCTGATATAGTCAGCAA
ATTTGGATAGTCTCTAGGGCTCATCATTTTTCATACTACCTCTCTCTTCTGGCCTGTGTC
TAAGGAATTGTACAACATAGGCCAGGGCCAACAAAGTGGAGAGGTGGACACATTTTCATG
TTCATTACTAAAACAAACAGCAAAACTATTGGTTTGTTATTCTGTGTTTTCCTCAAGTCA
GTACATACTATTTGGTTTCAGGATTTCTTTCCATTTCTCTATCAAGCATTAAATAATTGA
GAACTGTTTCTTCATCTCTGGTGTTCATGTCTTTTAATTAAATACGGAATTTTGGAGATG
ATAAGAGGGATAACCTGCGCTATGCCATTTTGCTTCCTTATCTCACTGTGTTCTTTCAGA
GTGTAGATATCTACCCAGGTCAAAATTCAGCCAAAAGCACTATTATGTAAAGATAATAAT
CCAAATCTTTCTCCCAAATACATGTGTACAGAATCATCCCCCAAGGTTTAGAGTCACCAA
TACCCTATTCTGAGCTTCTGCTGTATGTTTTATGTTTATAATTACAGTTCACAAAAAGGA
AGTTAGTCTTGTTTTTAAGATCAGAAGTGGGTGAGAGGACCTGTGATGAGGTTCCTGAGG
GTTTGGTGTTTACTAAGTAATATATCTTACTCTAGGTGCAGGGCTGATGGCAAGCCAAAG
AGCAACTGCCTTACTTTGATGTAAACAAAATTTGCTAAACTGAGCTGCTCAAAATTGTTT
TTATGGTAGTAGTGTTTCTTTGGATTGTATCATAATAGCTGCCAAAGGATAGGTAAAGAG
GTCATTAAAATGATGTTGAACTA

Protein Sequence

>22954 : length: 653
MAAAAASHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASSINGVR
CPFCSKITRITSLTQLTDNLTVLKIIDTAGLSEAVGLLMCRSCGRRLPRQFCRSCGLVLC
EPCREADHQPPGHCTLPVKEAAEERRRDFGEKLTRLRELMGELQRRKAALEGVSKDLQAR
YKAVLQEYGHEERRVQDELARSRKFFTGSLAEVEKSNSQVVEEQSYLLNIAEVQAVSRCD
YFLAKIKQADVALLEETADEEEPELTASLPRELTLQDVELLKVGHVGPLQIGQAVKKPRT
VNVEDSWAMEATASAASTSVTFREMDMSPEEVVASPRASPAKQRGPEAASNIQQCLFLKK
MGAKGSTPGMFNLPVSLYVTSQGEVLVADRGNYRIQVFTRKGFLKEIRRSPSGIDSFVLS
FLGADLPNLTPLSVAMNCQGLIGVTDSYDNSLKVYTLDGHCVACHRSQLSKPWGITALPS
GQFVVTDVEGGKLWCFTVDRGSGVVKYSCLCSAVRPKFVTCDAEGTVYFTQGLGLNLENR
QNEHHLEGGFSIGSVGPDGQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKEIL
HFPKGGGYSVLIREGLTCPVGIALTPKGQLLVLDCWDHCIKIYSYHLRRYSTP