ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

22931

Name

RAB18

Synonym

RAB18LI1|WARBM3;RAB18, member RAS oncogene family;RAB18;RAB18, member RAS oncogene family

Definition

RAB18 small GTPase|ras-related protein Rab-18

Position

10p12.1

Gene Type

protein-coding

External Links

Links to cell senescence gene database

22931

Links to epithelial mesenchymal transition gene database

22931

Links to ovarian cancer gene database

22931

Links to endometrial cancer gene database

22931

Links to iHOP

22931

Sequence Information

Nucleotide Sequence

>22931 : length: 5090
GGGGATTCTGGGTCGCGCAGCCGTGGAGCTACCTCAAGGCGGAACTGGGGAGTCCAGGGC
TTCGGCAGCCTGAACACCCGGTGTGAAAGGAAGGTGGCAGACGTGGAGCGGCGCGCATGC
GCAGCAGCTCACTCTGCTGAAGGGCTGAGAGGCGCACCCGGGCGGCCAGCTGGGCTCGGA
GCGGAACGGGGTCAGGATGGACGAGGACGTGCTAACCACCCTGAAGATCCTCATCATCGG
CGAGAGTGGGGTGGGCAAGTCCAGCCTGCTCTTGAGGTTCACAGATGATACGTTTGATCC
AGAACTTGCAGCAACAATAGGTGTTGACTTTAAGGTGAAAACAATTTCAGTGGATGGAAA
TAAGGCTAAACTTGCAATATGGGTTACTTTGCATCAGCAGACTGCAAACTTTTTCTTAAA
GAGCCAGATAGGAAATAGTCCAATCCTGAAGTGGGCCATGTGGCAATACGATACTGCTGG
TCAAGAGAGGTTTAGAACATTAACTCCCAGCTATTATAGAGGTGCACAGGGTGTTATATT
AGTTTATGATGTCACAAGAAGAGATACATTTGTTAAACTGGATAATTGGTTAAATGAATT
GGAAACATACTGTACAAGAAATGACATAGTAAACATGCTAGTTGGAAATAAAATCGATAA
GGAAAATCGTGAAGTCGATAGAAATGAAGGCCTGAAATTTGCACGAAAGCATTCCATGTT
ATTTATAGAGGCAAGTGCAAAAACCTGTGATGGTGTACAATGTGCCTTTGAAGAACTTGT
TGAAAAGATCATTCAGACCCCTGGACTGTGGGAAAGTGAGAACCAGAATAAAGGAGTCAA
ACTGTCACACAGGGAAGAAGGCCAAGGAGGAGGAGCCTGTGGTGGTTATTGCTCTGTGTT
ATAAACTCTGGGAAATTCCATCTCTTGCATATTTGATCAGATAGTGACATCTTTCTGTAT
ATAAACTCTTTAACTGCTATTTTAGGGACCTTGCAGTTTGCACATAATTGTTTTATATCA
TAGCAGTAAATATTTGCAAGAAATCCCACTCATCGACCCCGGGTAAAATGTTATGGTAAG
CATGCACAGTTTGCAGTCTACAGTTTTTTTATGTAGCACAAAATAGGTGTACCTTTATAA
GTACATTCAATTTTATGATTTACATTTATCATGTAATTTTTAAAAAAATCCATCTATCTA
GGATATGTTGATACAAAGTCTGCTTTTGCTATTCTTTTTGCTTAAATACTCCTATCATTT
TCTGAATTACTTGGTATTTAGAACTCCTAGCACCACGGGGAAGAATAGAGGTATCATCAA
ACGTGGCAAATTTTCTTTCAGGAATAATAAAGAGCATGATTCCACAGCTTTTCTGGGATG
TTTGAGATTCTTTTTTAGTACTAAGCAAAATTCTCATCACAGAATGTAGCCCAGGCCAAT
TTATAACTAAATCTCTATTTGTTCGGATGATGCTTCTAAAACAGCATTGATAGGTTAAAG
AAGCTTGGTATTTTTAATTTACTTCAATGATTAGCTCAGTTGCTTAACTGGAGTTTTAAT
CCTGTGATATGTACATTGGATTCATGACTGTGCAGCATTTTTAGTTATGTGGTGTTTGGC
AGAATGACAATAAGGTTTTCCCCCATTTTGGTTTCAGGAGGACATGAATAGTGTGTTTAT
TGTAACTCCTCATACACTTTTAAAACCAACATCTTTTTTCATAAATGTTGGTAGTGTTTG
TCCAGGTACCTTAACTGTAGCTTGTGTAATGTTGATGAATATCTGTATCTTACGGCTTCC
ATAATGGCTAGTTGATATTCAAAAACCTATTTCTGTGTTTTGAGGGGTGGGGAAAAAAAA
CACTAAGTGATAATTTGAAAAAGGCATATTGCTTCCAGATTCTGATGTGTGAGGGAAAAT
ACTGTCACAATGAAAATCTTGACAATTTACTTAACAAGTAACCAGTAGTTCATCAAAACC
AACTTGTACAGACTAATAAATCTTTTTCACAGTATTCAGTTTTCTCACCTCTTGCTATTG
TATATTGTAGATTTTTTTCATTCATGTGTTATTTAATTTACACTGATCTCTGCTATTTTA
ACCCCCCAAATAAGTTATTTGTCCTTTAAGGTTGGTTACTATAATACCCCTCAGTAAGAT
TCCAGTATTAATTTCTGGGCAGTTTGTTCTCTGTATACAATTGCAAATGATAAGCATTTT
TGTGAGTGACCACCTTTGCAATATGTTTGTTAATTTACTTCATGTTGGGTTCTTTCTGAA
ATGTACATCTTTACATATAAAAACCTCACATTCTACTTGATTTACACTTCCTAGTCTACA
TTACATGTGGTTGAAGGTTTTATACATTCTATATGCTTTTACTAAATATACAAGATTTAC
TACTAGAAATTTGGAGAAAGAACACTAACACATGTACTTGTGATTTGTTCATGTTATATT
AAAACTTGAGATTTGTGTATTTATGTAGAGTCTGTATTGACAAGACTGTTGTTTTTTGCT
CCTTGAGCTATATAATAATCTGTGTATTGGATTGTTGTCTTGATTTGGTCTAAATTTGAA
TATATATGAGTTACTTGAATATAACAAAAATGAATTTTGTTTGATAGATTTATATTGTAA
CCTTTTTCTAGTTCTTGAATAAATATAGCCTGCTTTCCCTAGATGCATTTGTGTAGGAAG
TATATACATTTCCCTATTACTCTCATCAGCTGAAGAATATGTACTATTGTGTTACTCAAA
TTATGTGGCTTTCATTTTGTTGTTTTGTTGCAAGCTTAGTGTTTTGTAGTGGAGGTTTTG
TAAATGAAACAGTTGTAATATCTAAGGTCAGGCACCTAGTAACAGGGTTTTGTTAATTCT
TTTCAGAATCATTGAAGCAGTCTTAAAGGGTCTTTTGCAGATGGTACAAATTAGAACAAT
TAGAATATAGTATTTTGAGTTCTAGTAGTACTGAGATTGACCCAAACAAATAAAAAACTA
TTCAATTTCTGAGTAATAGTTAATATTTATTGAAAGCTTCCTTGGTGCCAGATGCCTTTC
TAAGTGCTGAATTATCTCATTAAACCTCACAGCAACCTTAAGAGATTAGTACTCCTATTA
TGCCCATTTTAAAGGTGAGGACAACACAATGTAGGTATGTTAGGTAACCCCCAAAGATCA
CATAGCTACTCAGTCACTGAGCTGGATTCCAGTCATGGCATTTTTACTTCTGAGCCCATA
CTCTTCACCATCGCTCATTTTACAATGGGTAGTTAGTTACCAGCTTTTTGTAACACAACC
AAGTTAAGGCAGTTCCACTATTTCTTTATCACTCTTTTGTTATATGTAATAGAAGTATTT
CACACTTTTGGGTTATAGAGTAAATCCCATGATGTAAACCTACCTCATAAGTCATGTGAC
ATAAAAGTTAAGGTAGTGGAGTAGGTGGTCTTATTTCTTTCACCTGCTCAGAGTGGACTG
AAAATCCTGACTTAGAAAAGGTACAAAGTTAGGGGACTTATGGTACCTTCACTTTTTATG
TGAGAATAGAAATTATGGAAACAGTAATTTGCTCAAAACTGAAATCTGGGGTGATGTTTT
CATTTCATGTATTTGATTGCCATCCATAAACTCATACTTGGTGTTGACATTCTAGCTGAG
TGTTGTGGAAATAGACTTGATTTTGATTCATCGTAGCTTGCATGGTCAAGAGACATGATT
CTCTACTAAGGGTGGGGCTAGCACCATAGCTCATAAAAGAATCCTTCTTACACCAGTACT
TGTTCTGCCTGTGAGTTGGCACAGACTTACCTAATAACCATAGTGTCTTTAAGTACAACT
TAATACATATTTTTTCTGTGTATTTTTTTCAAATGAACTCAACAATTCTTCAGGTATTAT
AGATCAGAGATCCTCTCCATATTCAAGCATTATGCTTCTCTTTCTTGGGGGTACATTTCA
CTAGTAATACTTAGGAAGTTATTTTGTCTTTCCTGTATTTCCCTAGTTAAGTATAGGGGT
AAAAACGTTATTCAGCTTTCAGAAGACATTGTTCTGACTCCGACCCTGCCGTGTATACTC
AACTATATAGACTTCACCCTGGGTTTTGCCTAAACTGTTGAAAGACGAGAATAAATAGAC
ATAGACAGGCTAGCTAAGTCAAGACTAGGGGCTAAGGAATATAGAATCACCCAGGTCTTT
TTTTTTTTTTTTAATTTTTCTCTCCTCAGTTGGGAACATCTATCATGCTGGAGGACTACT
GTGATGGGGCTTTACATTTTACTGTTTTGTTGCTAGCTTATTGTTTCATACTTGGGAATC
AGTCATGTTTCTGATTGTGGTATAAAGTTTGCTTAAGTGCCCCTTAGTTAAAGCTGTTCA
ATGAATGTAAGCACACACACACCTACACACATATTTTGAATAGTCGTGTGTTCATGCCTG
TTCTCAGTCTTGTCCCCTTTACCGTTTCTCATGCAGGTTATTTCTTGCTTTTTTTTTTTT
TCCTCTTTTTTAACCGGAGAAGCAACAAATTACGTAGTTTTTTTTGTGTTTCTTTGATTA
CTAGTGAGCTTGAGTACTTTTAATATTTTATTGGATATGTTTGTGACTGACTTTAATTTC
TTGTTTGTGTGTGCTGTGGCTGCCCGATCCAGCACCTACTTCCTTCTCCCACCATACCAC
CCCCACCCCCACCCCTGCAAACAATTGGCATGTGGTTTGGGTGGCATTGTCACACCCTCG
GCTTTCTAGATTAACCCAGTTACCTTTTAGCAGTGCCCCACTTCCCCAGTAGCAATGGTT
CAGGGGTAGGCACCTGACCCAGACCAGACTACTGAGATAAAGATGTTTGCCTAGGCTTTT
TCAGGAGCAATTGAAGACATCTTGTTGGAGATAGTGTGCTGGGAGGAGTCACATTCTGAA
CTTGCTGCAGCTCGTTTTTCTAATATAAAGGAACCAGCCTGAGGCAGTACCAGGGTGAGA
GGGAGTCTATTGGAGCCCTTGGGAACTTCTGGATCAAATTGGACCTGAATTGAGATCTAT
TTCTCAGCTTTCACTTATGTGAGCCAATAAATTCCTTTTTTGTTGAAGGC

Protein Sequence

>22931 : length: 235
MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLA
IWVTLHQQTANFFLKSQIGNSPILKWAMWQYDTAGQERFRTLTPSYYRGAQGVILVYDVT
RRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEAS
AKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYCSVL