ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

22919

Name

MAPRE1

Synonym

EB1;microtubule-associated protein, RP/EB family, member 1;MAPRE1;microtubule-associated protein, RP/EB family, member 1

Definition

APC-binding protein EB1|adenomatous polyposis coli-binding protein EB1|end-binding protein 1|microtubule-associated protein RP/EB family member 1

Position

20q11.1-q11.23

Gene Type

protein-coding

Pathways and Diseases

Pathway

N-cadherin signaling events;PID Curated;200180

Pathway

Recruitment of mitotic centrosome proteins and complexes;PID Reactome;500381

Pathway

Centrosome maturation;PID Reactome;500380

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

Pathway

Loss of Nlp from mitotic centrosomes;PID Reactome;500384

Pathway

Loss of proteins required for interphase microtubule organization from the centrosome;PID Reactome;500383

Pathway

DNA Replication;Reactome;REACT:383

External Links

Links to cell senescence gene database

22919

Links to epithelial mesenchymal transition gene database

22919

Links to ovarian cancer gene database

22919

Links to endometrial cancer gene database

22919

Links to iHOP

22919

Sequence Information

Nucleotide Sequence

>22919 : length: 2640
CTTTACGTCGGCGCGTAACGAGGGGGTGCGTGTGAGGTCATCGCGCGGGCGGGCGGGCGG
GGTCTGGCGGTTTGAACGAGACGAAGACGGAACCGGAGCCGGTTGCGGGCAGTGGACGCG
GTTCTGCCGAGAGCCGAAGATGGCAGTGAACGTATACTCAACGTCAGTGACCAGTGATAA
CCTAAGTCGACATGACATGCTGGCCTGGATCAATGAGTCTCTGCAGTTGAATCTGACAAA
GATCGAACAGTTGTGCTCAGGGGCTGCGTATTGTCAGTTTATGGACATGCTGTTCCCTGG
CTCCATTGCCTTGAAGAAAGTGAAATTCCAAGCTAAGCTAGAACACGAGTACATCCAGAA
CTTCAAAATACTACAAGCAGGTTTTAAGAGAATGGGTGTTGACAAAATAATTCCTGTGGA
CAAATTAGTAAAAGGAAAGTTTCAGGACAATTTTGAATTCGTTCAGTGGTTCAAGAAGTT
TTTCGATGCAAACTATGATGGAAAAGACTATGACCCTGTGGCTGCCAGACAAGGTCAAGA
AACTGCAGTGGCTCCTTCCCTTGTTGCTCCAGCTCTGAATAAACCGAAGAAACCTCTCAC
TTCTAGCAGTGCAGCTCCCCAGAGGCCCATCTCAACACAGAGAACCGCTGCGGCTCCTAA
GGCTGGCCCTGGTGTGGTGCGAAAGAACCCTGGTGTGGGCAACGGAGACGACGAGGCAGC
TGAGTTGATGCAGCAGGTCAACGTATTGAAACTTACTGTTGAAGACTTGGAGAAAGAGAG
GGATTTCTACTTCGGAAAGCTACGGAACATTGAATTGATTTGCCAGGAGAACGAGGGGGA
AAACGACCCTGTATTGCAGAGGATTGTAGACATTCTGTATGCCACAGATGAAGGCTTTGT
GATACCTGATGAAGGGGGCCCACAGGAGGAGCAAGAAGAGTATTAACAGCCTGGACCAGC
AGAGCAACATCGGAATTCTTCACTCCAAATCATGTGCTTAACTGTAAAATACTCCCTTTT
GTTATCCTTAGAGGACTCACTGGTTTCTTTTCATAAGCAAAAAGTACCTCTTCTTAAAGT
GCACTTTGCAGACGTTTCACTCCTTTTCCAATAAGTTTGAGTTAGGAGCTTTTACCTTGT
AGCAGAGCAGTATTAACACCTAGTTGGTTCACCTGGAAAACAGAGAGGCTGACCGTGGGG
CTCACCATGCGGATGCGGGTCACACTGAATGCTGGAGAGATGTTATGTAATATGCTGAGG
TGGCGACCTCAGTGGAGAAATGTAAAGACTGAATTGAATTTTAAGCTAATGTGAAATCAG
AGAATGTTGTAATAAGTAAATGCCTTAAGAGTATTTAAAATATGCTTCCACATTTCAAAA
TATAAAATGTAACATGACAAGAGATTTTGCGTTTGACATTGTGTCTGGGAAGGAAGGGCC
AGACCTTGGAACCTTTGGAACCTGCTGTCAACAGGTCTTACAGGGCTGCTTGAACCCTCA
TAGGCCTAGGCTTTGGTCTAAAAGGAACATTTAAAAAGTTGCCCTGTAAAGTTATTTGGT
GTCATTGACCAATTGCATCCCAGCTAAAAAGCAAGAGGCATCGTTGCCTGGATAATAGAG
GATGTGTTTCAGCCCTGAGATGTTACAGTTGAAGAGCTTGGTTTTCATTGAGCATTTCTC
TATTTTTCCAGTTATCCCCGAAATTTCTATGTATTATATTTTTTGGGGAAGTGAGGTGTG
CCCAGTTTTTTAATCTAACAACTACTTTTGGGGACTTGCCCACATCTCTGGGATTTGAAT
GGGGATTGTATCCCATTTTACTGTCTTTTAGGTTTACATTTACCACGTTTCTCTTCTCTG
CTCCCCTTGCCCACTGGGGACTCCTCTTTGGCTCCTTGAAGTTTGCTGCTTAGAGTTGGA
AGTGCAGCAGGCAGGTGATCATGCTGCAAGTTCTTTCTGGACCTCTGGCAAAGGGAGTGG
TCAGTGAAGGCCATCGTTACCTTGGGATCTGCCAGGCTGGGGTGTTTTCGGTATCTGCTG
TTCACAGCTCTCCACTGTAATCCGAATACTTTGCCAGTGCACTAATCTCTTTGGAGATAA
AATTCATTAGTGTGTTACTAAATGTTAATTTTCTTTTGCGGAAAATACAGTACCGTGTCT
GAATTAATTATTAATATTTAAAATACTTCATTCCTTAACTCTCCCTCATTTGCTTTGCCC
ACAGCCTATTCAGTTCCTTTGTTTGGCAGGATTCTGCAAAATGTGTCTCACCCACTACTG
AGATTGTTCAGCCCCTGATGTATTTGTATTGATTTGTTTCTGGTGGTAGCTTGTCCTGAA
ATGTGTGTAGAAAGCAAGTATTTTATGATAAAAATGTTGTGTAGTGCATGCTCTGTGTGG
AATTCAGAGGAAAACCCAGATTCAGTGATTAACAATGCCAAAAAATGCAAGTAACTAGCC
ATTGTTCAAATGACAGTGGTGCTATTTCTCTTTTGTGGCCTTTTAGACTTTTGTTGCCCT
AAAATTCCATTTTATTGGGAACCCATTTTCCACCTGGTCTTTCTTGACAGGGTTTTTTTC
TACTTTAAACAGTTTCTAAATAAAATTCTGTATTTCAAGAGTAAAAAAAAAAAAAAAAAA

Protein Sequence

>22919 : length: 268
MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKK
VKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYD
GKDYDPVAARQGQETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVV
RKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQ
RIVDILYATDEGFVIPDEGGPQEEQEEY