ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

22800

Name

RRAS2

Synonym

TC21;related RAS viral (r-ras) oncogene homolog 2;RRAS2;related RAS viral (r-ras) oncogene homolog 2

Definition

ras-like protein TC21|ras-related protein R-Ras2|teratocarcinoma oncogene

Position

11p15.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

Tight junction;KEGG PATHWAY;hsa04530

Pathway

TGF-beta signaling pathway;PANTHER;P00052

Pathway

EGF receptor signaling pathway;PANTHER;P00018

Pathway

Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031

Disease

Ovarian carcinoma;OMIM

External Links

Links to cell senescence gene database

22800

Links to epithelial mesenchymal transition gene database

22800

Links to ovarian cancer gene database

22800

Links to endometrial cancer gene database

22800

Links to iHOP

22800

Sequence Information

Nucleotide Sequence

>22800 : length: 2360
CAGACGGCCATTTGTGGCGGCGCTGGAGGCTGCGTTCGGCAGGCGCTGCGGAGACGCGTA
GAGGAGCGCGCCCCCCGGCCGCTGCCGCCCCTGGCCCGTGCCGTCACCCCGCTTCTCCGC
GCCTCGGGCGGTACCCAGCCAGTCCCCAGCGCCGCGCTACCGCGCTGACCGGCCCTCCAG
ACGCCTCCCGGTACCCGGGACCCCAGCCCGGCCGCTCGCCCGCAGCCCGCCGGCCGCACA
CGTCCCCGGAGCCGGGCCTAGGGCGGGCGGCAGCGGCGGCTCGGCGCAGTCAGGCTGGGC
TCTGTAGCGTCCCCATGGCCGCGGCCGGCTGGCGGGACGGCTCCGGCCAGGAGAAGTACC
GGCTCGTGGTGGTCGGCGGGGGCGGCGTGGGCAAGTCGGCGCTCACCATCCAGTTCATCC
AGTCCTATTTTGTAACGGATTATGATCCAACCATTGAAGATTCTTACACAAAGCAGTGTG
TGATAGATGACAGAGCAGCCCGGCTAGATATTTTGGATACAGCAGGACAAGAAGAGTTTG
GAGCCATGAGAGAACAGTATATGAGGACTGGCGAAGGCTTCCTGTTGGTCTTTTCAGTCA
CAGATAGAGGCAGTTTTGAAGAAATCTATAAGTTTCAAAGACAGATTCTCAGAGTAAAGG
ATCGTGATGAGTTCCCAATGATTTTAATTGGTAATAAAGCAGATCTGGATCATCAAAGAC
AGGTAACACAGGAAGAAGGACAACAGTTAGCACGGCAGCTTAAGGTAACATACATGGAGG
CATCAGCAAAGATTAGGATGAATGTAGATCAAGCTTTCCATGAACTTGTCCGGGTTATCA
GGAAATTTCAAGAGCAGGAATGTCCTCCTTCACCAGAACCAACACGGAAAGAAAAAGACA
AGAAAGGCTGCCATTGTGTCATTTTCTAGAATCCCTTCAGTTTTAGCTACCAACGGCCAG
GAAAAGCCCTCATCTTCTCTTTCTCTCCTCAGTTTACATCTTGTTGGTACCTTTCTAGCC
TTAGACAAATGATCACCATGTTAGCCTTAGACGAAGAAGCTGGCTAGTCCTTTCTGTGAA
GCTAATACAATGGTCATTTCCAGACAAATTTAAAGGAAACACTAAGGCTGCTTCAAAGAT
TATCTGATTCCTTTAAAATATATGTCTATATACACAGACATGCTCTTTTTTTAAGTGCTT
ACATTTTAATAGAGATGAATCAGTTTTGGAATCTAAGCTGTTTGCCAAGCTGAAGCTACA
GGTTGTGAAATAATTTTTAACTTTTGGAATCATACTGCCTACTGTTACTCTAAATAGAAA
TATAGGGTTTTTTTTAATGTGAATTTTTGCCTATCTTTAAACATTTCAATGTCAGCCTTT
GTTAACCTTAAATACACTGAATTGAATCTACAAAAGTGAACCATCTCAGACCTTTACTGA
TACTACAACTTTTGTTTTCTGATGGCCAAAATACCAAATGCCTGTTGTATTTATGGATTA
AAAACTGCTTATAAAACCCTGTGTTACTACTCCTACTCTTGGAGATGATAATATTCTATG
TGGTCAAATATTTGGACTCATTTAGGACTTAGATATTTCAGTGTACTTGATTTTTTAATT
TAACTCTTTTTCACAGCCACGCTAAGGGTAAAAAGGAATAATTTCCTTCTGTCTTCCTTT
TCAAGTATTTCTGGGTAAGGGATTCAAAAAACTAAAACTGTTTTTGTTTGTAATATAAAA
TATGGAATTGATCTTTCCAGGGTCAGAGATGATTAATGTTTTTGCTATATACTTTTATAC
ATTATTTTCTTATCAAACTAGTTAACAAGTATTTTTATATGTTTGTAAGCAGATATGCTT
TCATAGCATACCTTGTGTATATGTAAAGATAAGTATTTAATTCTCACTGTTCACTTTTAA
CTGACAAAGAAAAACAAGTGGAAACTACAGAAACTGTGGTAGAACTTTTACTTGCTGGTC
TGGTCTTGGTTGTACCCATCTTTGGCCAGTCACATAACTACTCAAGAAACCTTCCCAATA
GAGTACAACAGGATGAGACTCTGAAATCACTTTCAGTATTCCCTGCTAGATATTGATTGT
TATTTCAAGTATTAAGTGTAAGCTTTTAATGGATAATTAGTATAACTGTGGATGGCATCT
GATTTTGTTTTTAATTCTGTGGATTGTGTTTAAGCAATTCAATAGTATGTTCCTGATTTT
GAGATGCTAAGTGGTATTGCACAGTTGTCACTTTATCAAGTGTGTACAACAGTCCCATGA
AGTTTATAGAGCATACCCTTGTATAGCTTCAGGTGCTAGAATTAAAATTGATCTGTTATC
ACAAGAAAAAAAAAAAAAAA

Protein Sequence

>22800 : length: 204
MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDR
AARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEF
PMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQE
QECPPSPEPTRKEKDKKGCHCVIF