ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2274

Name

FHL2

Synonym

AAG11|DRAL|FHL-2|SLIM-3|SLIM3;four and a half LIM domains 2;FHL2;four and a half LIM domains 2

Definition

LIM domain protein DRAL|aging-associated gene 11|down-regulated in rhabdomyosarcoma LIM protein|four and a half LIM domains protein 2|skeletal muscle LIM-protein 3

Position

2q12.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Coregulation of Androgen receptor activity;PID Curated;200038

Pathway

Metabolism of lipids and lipoproteins;Reactome;REACT:22258

Pathway

Signaling events mediated by HDAC Class III;PID Curated;200020

Pathway

hypoxia and p53 in the cardiovascular system;PID BioCarta;100084

Disease

Embryoma;FunDO

Disease

Polyarthritis;FunDO

Disease

Gastrointestinal cancer;FunDO

Disease

Breast cancer;FunDO

Disease

Prostate cancer;FunDO

External Links

Links to cell senescence gene database

2274

Links to epithelial mesenchymal transition gene database

2274

Links to ovarian cancer gene database

2274

Links to endometrial cancer gene database

2274

Links to iHOP

2274

Sequence Information

Nucleotide Sequence

>2274 : length: 2108
CTCCACTCGGCCGGCAGCGGAGCCGCAGCCACCAGCCGCCCGCGCCCTCCAGCCCCGTCC
GGGAGTCCCCGGCCCGCTGCGGTGCCGTGAGTACCTCCAACCCCCTGCGCCCCGGAGGGA
GGCCGAGGGGCTTAGCCACCAGGGCTCGGAAGTGGGGGCCGAATCCGGTGCGAGACCCAA
GGAGAGGGGAGCAGAGCCGGAGTTGGGGAGACTGGTTGCTGAAAAGCCAGGAGTCAAAAT
GACTGAGCGCTTTGACTGCCACCATTGCAACGAATCTCTCTTTGGCAAGAAGTACATCCT
GCGGGAGGAGAGCCCCTACTGCGTGGTGTGCTTTGAGACCCTGTTCGCCAACACCTGCGA
GGAGTGTGGGAAGCCCATCGGCTGTGACTGCAAGGACAAGCATGAGAGCTCAGCCACCAG
ACTGCCCAGTTCCAGCCCAGGCTCTGTGTCTCACTTGCTGTGTGGCCTTGGGGCTGTGCC
GTGCCTGGAGCTCACAGATGGGGTAATGATGGTCATCACTAGTGTTTCAGATGTCTTTTT
GAAGCCGGGGCGTGTGCATGGAAAGAATGGAGACCATGCCTGTTCCCGAACGATGATGAT
GTCCATGTGGATTGTGGGCTTTGCTGTTTCTCATGAGTTCACATGTGTAGACATCAACTC
AAATCAAAGCAGTTTGTCCTCTATTTCACTTGTCAAAATAACCAATAAAGCACAGGTGAT
GTTCCCCTCAGATTTCTGAAAATACTTTAAGCTAAAAATACAAAAGACAGGTTAGCCCTC
TGCCCCCAACTCCCAGTGCATACCCAGTTTGGGTTCTCAAGGATGAAGAGGGCTTGGGCA
TTTCAGCAACCTGCCCCCGAGTCCCCCTGACAGGCAGTGCCTACCCCAGGGGACCCACAA
TACCCAGAGGTGCTGGGCTCAGGTGAGAATGAATTCCGCAGAAACAAGGGCATTTAGTCC
AGCTTTGAGAGCACTCTATGCTCCTCTCACCTTCATTCCTTTTGTTTTGAGACTGAGTCT
CCTTCTGTCACCAAGGCTGTGCAACCTCCACCTCCCAGGTTCAAGCGATTCTCCTGCCTC
AGCTTCCCAAGTAGCTGGGACTAAAGGCATGCACCACCACGCCCGGCTAATGTTTGTATT
TTTAGTGGAGATAGGGTTTCGCCATGTTGGCCAGGCTTGTCTTGAACTCCTGACCTCTCC
TTCATTCTTTATCGTCTTGCGTCAGCAATAATCCTATTCCCAGATGTTCTAGGAAGCAAA
CTTCCAACAGGGATAGCACAAGAGGTCACCCCTCACAAAGGCCATAGTCATGACTGTCTT
CAAAGTGTCTCAGCGTTCACATTTTTAAAATTCCTTGAACTAAAACAAAATGCGCAAAGA
GATCACTAAATCAAATAACTAGTTTGGTTCCAGGTTCCGGGAAAACACACATACATGCAC
ACATGTGCACACGCACGCGCACACACACACACACACACACACACATACTTCAGCAAAAGA
GAACTGTTTGTTCTAGTTTTGGTTCCGAGTTAGCTGGTGTTTTAGGACTTTCTAATCAAG
GCCAAGATCCATGTCTTCACATCCTACATTCAGCATAACTCCAGCTTCGACTTCGGTTTC
AGTAACAGAGACATCGTGGGCAGGCTCTTCTTCAGGGCCATCGCGTGAACAGCCCTCCTG
TGCCCTGTTCAGGATACCTACCAACTGGAAGCCTGCCCAGGAAACCGTGCAGAGCCTAAT
ACTCTGTTTCTGCCTCATGTATAAATGGATGATGATTTGGGGTCAGAGCTGGGAACACAA
AGACAGCAATAGAAACATATCCTTTCTAAGATAAAGCTGGGCATAAAGAGATTGTTATTT
TAATTTTGTGTTGGCACTTTAAAAATGCCGTATGTCATTTTTAAAAGGCAAATATGGAGG
GTTCTCTTATTCCTCAGGCAAGATGAAGCCAAGTGTGGAGTCGAGTTTTCTGCGGGGCTC
CTTTCTCTCCCTCATCTTTTACTCAAAAGCACACGTCTGTCTTCTCAGGGCCTCTCTCAT
GTGTGCTCAGTTTTTGTCTCACTTCTCCCACCCTCACGCCCCTCCACTCCCACATCCTTA
CCCGTCCC

Protein Sequence

>2274 : length: 389
MTRRGFSRAGAAQRSTRPAAEPQPPAARALQPRPGVPGPLRCREYLQPPAPRREAEGLSH
QGSEVGAESGARPKERGAEPELGRLWLRTVSSWRLGWHFDFGVAEKPGVKMTERFDCHHC
NESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQ
CRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICH
RCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTA
CRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFN
CKKCSLSLVGRGFLTERDDILCPDCGKDI