ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2268

Name

FGR

Synonym

SRC2|c-fgr|c-src2|p55-Fgr|p55c-fgr|p58-Fgr|p58c-fgr;FGR proto-oncogene, Src family tyrosine kinase;FGR;FGR proto-oncogene, Src family tyrosine kinase

Definition

Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog|c-fgr protooncogene|c-src-2 proto-oncogene|feline Gardner-Rasheed sarcoma viral oncogene homolog|p55-c-fgr protein|proto-oncogene c-Fgr|proto-oncogene tyrosine-protein kinase FGR|tyrosine-prote

Position

1p36.2-p36.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

roles of beta arrestin dependent recruitment of src kinases in gpcr signaling;PID BioCarta;100230

Pathway

Parkinson disease;PANTHER;P00049

Pathway

Signaling events mediated by PTP1B;PID Curated;200033

Pathway

Ephrin B reverse signaling;PID Curated;200173

Pathway

Hemostasis;Reactome;REACT:604

Pathway

Alpha-synuclein signaling;PID Curated;200187

Pathway

Thromboxane A2 receptor signaling;PID Curated;200069

Pathway

PDGFR-beta signaling pathway;PID Curated;200127

Pathway

EPHA forward signaling;PID Curated;200121

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

Glypican 1 network;PID Curated;200021

External Links

Links to cell senescence gene database

2268

Links to epithelial mesenchymal transition gene database

2268

Links to ovarian cancer gene database

2268

Links to endometrial cancer gene database

2268

Links to iHOP

2268

Sequence Information

Nucleotide Sequence

>2268 : length: 2501
CTCTGAGTGTTGCAATGGCAATGTTTCTGGCAGGGTGTGGGGGACCCTTGCTCAATGACC
TCCTGCCCTGTTGCTCAGAGGATACCGCTGCCAGAAAAGGGTTGGCTCATTGTGGGGCTT
CCCAAGGTACTCTGGTAGCCCCAGCTTCTGACCTGGTCCTTTCTCTGGTATGGGGATAGG
AGGAGAGCTCCGGAGGTCTCTGACCCCTCCCAAGGATCATGCCGCAGCCCCACTGACCCA
GGAGTAGGGGCCTAAGGGCAGGGAACCTGGAATGGGCTGTGTGTTCTGCAAGAAATTGGA
GCCGGTGGCCACGGCCAAGGAGGATGCTGGCCTGGAAGGGGACTTCAGAAGCTACGGGGC
AGCAGACCACTATGGGCCTGACCCCACTAAGGCCCGGCCTGCATCCTCATTTGCCCACAT
CCCCAACTACAGCAACTTCTCCTCTCAGGCCATCAACCCTGGCTTCCTTGATAGTGGCAC
CATCAGGGGTGTGTCAGGGATTGGGGTGACCCTGTTCATTGCCCTGTATGACTATGAGGC
TCGAACTGAGGATGACCTCACCTTCACCAAGGGCGAGAAGTTCCACATCCTGAACAATAC
TGAAGGTGACTGGTGGGAGGCTCGGTCTCTCAGCTCCGGAAAAACTGGCTGCATTCCCAG
CAACTACGTGGCCCCTGTTGACTCAATCCAAGCTGAAGAGTGGTACTTTGGAAAGATTGG
GAGAAAGGATGCAGAGAGGCAGCTGCTTTCACCAGGCAACCCCCAGGGGGCCTTTCTCAT
TCGGGAAAGCGAGACCACCAAAGGTGCCTACTCCCTGTCCATCCGGGACTGGGATCAGAC
CAGAGGCGATCATGTGAAGCATTACAAGATCCGCAAACTGGACATGGGCGGCTACTACAT
CACCACACGGGTTCAGTTCAACTCGGTGCAGGAGCTGGTGCAGCACTACATGGAGGTGAA
TGACGGGCTGTGCAACCTGCTCATCGCGCCCTGCACCATCATGAAGCCGCAGACGCTGGG
CCTGGCCAAGGACGCCTGGGAGATCAGCCGCAGCTCCATCACGCTGGAGCGCCGGCTGGG
CACCGGCTGCTTCGGGGATGTGTGGCTGGGCACGTGGAACGGCAGCACTAAGGTGGCGGT
GAAGACGCTGAAGCCGGGCACCATGTCCCCGAAGGCCTTCCTGGAGGAGGCGCAGGTCAT
GAAGCTGCTGCGGCACGACAAGCTGGTGCAGCTGTACGCCGTGGTGTCGGAGGAGCCCAT
CTACATCGTGACCGAGTTCATGTGTCACGGCAGCTTGCTGGATTTTCTCAAGAACCCAGA
GGGCCAGGATTTGAGGCTGCCCCAATTGGTGGACATGGCAGCCCAGGTAGCTGAGGGCAT
GGCCTACATGGAACGCATGAACTACATTCACCGCGACCTGAGGGCAGCCAACATCCTGGT
TGGGGAGCGGCTGGCGTGCAAGATCGCAGACTTTGGCTTGGCGCGTCTCATCAAGGACGA
TGAGTACAACCCCTGCCAAGGTTCCAAGTTCCCCATCAAGTGGACAGCCCCAGAAGCTGC
CCTCTTTGGCAGATTCACCATCAAGTCAGACGTGTGGTCCTTTGGGATCCTGCTCACTGA
GCTCATCACCAAGGGCCGAATCCCCTACCCAGGCATGAATAAACGGGAAGTGTTGGAACA
GGTGGAGCAGGGCTACCACATGCCGTGCCCTCCAGGCTGCCCAGCATCCCTGTACGAGGC
CATGGAACAGACCTGGCGTCTGGACCCGGAGGAGAGGCCTACCTTCGAGTACCTGCAGTC
CTTCCTGGAGGACTACTTCACCTCCGCTGAACCACAGTACCAGCCCGGGGATCAGACATA
GCCTGTCCGGGCATCAACCCTCTCTGGCGGTGGCCACCAGTCCTTGCCAATCCCCAGAGC
TGTTCTTCCAAAGCCCCCAGGCTGGCTTAGAACCCCATAGAGTCCTAGCATCACCGAGGA
CGTGGCTGCTCTGACACCACCTAGGGCAACCTACTTGTTTTACAGATGGGGCAAAAGGAG
GCCCAGAGCTGATCTCTCATCCGCTCTGGCCCCAAGCACTATTTCTTCCTTTTCCACTTA
GGCCCCTACATGCCTGTAGCCTTTCTCACTCCATCCCCACCCAAAGTGCTCAGACCTTGT
CTAGTTATTTATAAAACTGTATGTACCTCCCTCACTTCTCTCCTATCACTGCTTTCCTAC
TCTCCTTTTATCTCACTCTAGTCCAGGTGCCAAGAATTTCCCTTCTACCCTCTATTCTCT
TGTGTCTGTAAGTTACAAAGTCAGGAAAAGTCTTGGCTGGACCCCTTTCCTGCTGGGTGG
ATGCAGTGGTCCAGGACTGGGGTCTGGGCCCAGGTTTGAGGGAGAAGGTTGCAGAGCACT
TCCCACCTCTCTGAATAGTGTGTATGTGTTGGTTTATTGATTCTGTAAATAAGTAAAATG
ACAATATGAATCCTCAAACCATGAAAAAAAAAAAAAAAAAA

Protein Sequence

>2268 : length: 529
MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQA
INPGFLDSGTIRGVSGIGVTLFIALYDYEARTEDDLTFTKGEKFHILNNTEGDWWEARSL
SSGKTGCIPSNYVAPVDSIQAEEWYFGKIGRKDAERQLLSPGNPQGAFLIRESETTKGAY
SLSIRDWDQTRGDHVKHYKIRKLDMGGYYITTRVQFNSVQELVQHYMEVNDGLCNLLIAP
CTIMKPQTLGLAKDAWEISRSSITLERRLGTGCFGDVWLGTWNGSTKVAVKTLKPGTMSP
KAFLEEAQVMKLLRHDKLVQLYAVVSEEPIYIVTEFMCHGSLLDFLKNPEGQDLRLPQLV
DMAAQVAEGMAYMERMNYIHRDLRAANILVGERLACKIADFGLARLIKDDEYNPCQGSKF
PIKWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMNKREVLEQVEQGYHMPCP
PGCPASLYEAMEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQT