ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2261

Name

FGFR3

Synonym

ACH|CD333|CEK2|HSFGFR3EX|JTK4;fibroblast growth factor receptor 3;FGFR3;fibroblast growth factor receptor 3

Definition

FGFR-3|fibroblast growth factor receptor 3 variant 4|hydroxyaryl-protein kinase|tyrosine kinase JTK4

Position

4p16.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

FGFR3c ligand binding and activation;PID Reactome;500245

Pathway

Signaling by Insulin receptor;Reactome;REACT:498

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

Signaling by FGFR;Reactome;REACT:9470

Pathway

FGFR3b ligand binding and activation;PID Reactome;500244

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

FGF signaling pathway;PANTHER;P00021

Pathway

Bladder cancer;KEGG PATHWAY;hsa05219

Pathway

FGF signaling pathway;PID Curated;200189

Disease

Muenke syndrome;OMIM

Disease

Intracranial hypertension;FunDO

Disease

LADD syndrome;OMIM

Disease

bladder cancer;GAD

Disease

Cancer;FunDO

Disease

Cervical cancer, somatic;OMIM

Disease

Multiple Myeloma;GAD

Disease

Keratosis;FunDO

Disease

Multiple myeloma;KEGG DISEASE;H00010

Disease

CATSHL syndrome;OMIM

Disease

Crouzon syndrome with acanthosis nigricans;OMIM

Disease

Bladder cancer, somatic;OMIM

Disease

Cancers of haematopoietic and lymphoid tissues;KEGG DISEASE

Disease

Colorectal cancer, somatic;OMIM

Disease

Hypochondroplasia;OMIM

Disease

craniosynostosis;GAD

Disease

Ptosis;FunDO

Disease

thanatophoric dysplasia;GAD

Disease

Nevus, keratinocytic, nonepidermolytic;OMIM

Disease

CANCER;GAD

Disease

Thanatophoric dysplasia, type I;OMIM

Disease

Bladder cancer;KEGG DISEASE;H00022

Disease

Turner's syndrome;FunDO

Disease

Cancers;KEGG DISEASE

Disease

Bone disease;FunDO

Disease

Achondroplasia;OMIM

Disease

Cancers of the urinary system and male genital organs;KEGG DISEASE

Disease

Craniosynostosis;FunDO

Disease

Hyperopia;FunDO

External Links

Links to cell senescence gene database

2261

Links to epithelial mesenchymal transition gene database

2261

Links to ovarian cancer gene database

2261

Links to endometrial cancer gene database

2261

Links to iHOP

2261

Sequence Information

Nucleotide Sequence

>2261 : length: 4315
CGGTGGCGGCGGCGTCGCGGGCAGCTGGCGCCGCGCGGTCCTGCTCTGCCGGTCGCACGG
ACGCACCGGCGGGCCGCCGGCCGGAGGGACGGGGCGGGAGCTGGGCCCGCGGACAGCGAG
CCGGAGCGGGAGCCGCGCGTAGCGAGCCGGGCTCCGGCGCTCGCCAGTCTCCCGAGCGGC
GCCCGCCTCCCGCCGGTGCCCGCGCCGGGCCGTGGGGGGCAGCATGCCCGCGCGCGCTGC
CTGAGGACGCCGCGGCCCCCGCCCCCGCCATGGGCGCCCCTGCCTGCGCCCTCGCGCTCT
GCGTGGCCGTGGCCATCGTGGCCGGCGCCTCCTCGGAGTCCTTGGGGACGGAGCAGCGCG
TCGTGGGGCGAGCGGCAGAAGTCCCGGGCCCAGAGCCCGGCCAGCAGGAGCAGTTGGTCT
TCGGCAGCGGGGATGCTGTGGAGCTGAGCTGTCCCCCGCCCGGGGGTGGTCCCATGGGGC
CCACTGTCTGGGTCAAGGATGGCACAGGGCTGGTGCCCTCGGAGCGTGTCCTGGTGGGGC
CCCAGCGGCTGCAGGTGCTGAATGCCTCCCACGAGGACTCCGGGGCCTACAGCTGCCGGC
AGCGGCTCACGCAGCGCGTACTGTGCCACTTCAGTGTGCGGGTGACAGACGCTCCATCCT
CGGGAGATGACGAAGACGGGGAGGACGAGGCTGAGGACACAGGTGTGGACACAGGGGCCC
CTTACTGGACACGGCCCGAGCGGATGGACAAGAAGCTGCTGGCCGTGCCGGCCGCCAACA
CCGTCCGCTTCCGCTGCCCAGCCGCTGGCAACCCCACTCCCTCCATCTCCTGGCTGAAGA
ACGGCAGGGAGTTCCGCGGCGAGCACCGCATTGGAGGCATCAAGCTGCGGCATCAGCAGT
GGAGCCTGGTCATGGAAAGCGTGGTGCCCTCGGACCGCGGCAACTACACCTGCGTCGTGG
AGAACAAGTTTGGCAGCATCCGGCAGACGTACACGCTGGACGTGCTGGAGCGCTCCCCGC
ACCGGCCCATCCTGCAGGCGGGGCTGCCGGCCAACCAGACGGCGGTGCTGGGCAGCGACG
TGGAGTTCCACTGCAAGGTGTACAGTGACGCACAGCCCCACATCCAGTGGCTCAAGCACG
TGGAGGTGAATGGCAGCAAGGTGGGCCCGGACGGCACACCCTACGTTACCGTGCTCAAGT
CCTGGATCAGTGAGAGTGTGGAGGCCGACGTGCGCCTCCGCCTGGCCAATGTGTCGGAGC
GGGACGGGGGCGAGTACCTCTGTCGAGCCACCAATTTCATAGGCGTGGCCGAGAAGGCCT
TTTGGCTGAGCGTTCACGGGCCCCGAGCAGCCGAGGAGGAGCTGGTGGAGGCTGACGAGG
CGGGCAGTGTGTATGCAGGCATCCTCAGCTACGGGGTGGGCTTCTTCCTGTTCATCCTGG
TGGTGGCGGCTGTGACGCTCTGCCGCCTGCGCAGCCCCCCCAAGAAAGGCCTGGGCTCCC
CCACCGTGCACAAGATCTCCCGCTTCCCGCTCAAGCGACAGGTAACAGTGTCCCTGGAGT
CCAACGCGTCCATGAGCTCCAACACACCACTGGTGCGCATCGCAAGGCTGTCCTCAGGGG
AGGGCCCCACGCTGGCCAATGTCTCCGAGCTCGAGCTGCCTGCCGACCCCAAATGGGAGC
TGTCTCGGGCCCGGCTGACCCTGGGCAAGCCCCTTGGGGAGGGCTGCTTCGGCCAGGTGG
TCATGGCGGAGGCCATCGGCATTGACAAGGACCGGGCCGCCAAGCCTGTCACCGTAGCCG
TGAAGATGCTGAAAGACGATGCCACTGACAAGGACCTGTCGGACCTGGTGTCTGAGATGG
AGATGATGAAGATGATCGGGAAACACAAAAACATCATCAACCTGCTGGGCGCCTGCACGC
AGGGCGGGCCCCTGTACGTGCTGGTGGAGTACGCGGCCAAGGGTAACCTGCGGGAGTTTC
TGCGGGCGCGGCGGCCCCCGGGCCTGGACTACTCCTTCGACACCTGCAAGCCGCCCGAGG
AGCAGCTCACCTTCAAGGACCTGGTGTCCTGTGCCTACCAGGTGGCCCGGGGCATGGAGT
ACTTGGCCTCCCAGAAGTGCATCCACAGGGACCTGGCTGCCCGCAATGTGCTGGTGACCG
AGGACAACGTGATGAAGATCGCAGACTTCGGGCTGGCCCGGGACGTGCACAACCTCGACT
ACTACAAGAAGACGACCAACGGCCGGCTGCCCGTGAAGTGGATGGCGCCTGAGGCCTTGT
TTGACCGAGTCTACACTCACCAGAGTGACGTCTGGTCCTTTGGGGTCCTGCTCTGGGAGA
TCTTCACGCTGGGGGGCTCCCCGTACCCCGGCATCCCTGTGGAGGAGCTCTTCAAGCTGC
TGAAGGAGGGCCACCGCATGGACAAGCCCGCCAACTGCACACACGACCTGTACATGATCA
TGCGGGAGTGCTGGCATGCCGCGCCCTCCCAGAGGCCCACCTTCAAGCAGCTGGTGGAGG
ACCTGGACCGTGTCCTTACCGTGACGTCCACCGACCAGGAGTACCTGGACCTGTCGGCGC
CTTTCGAGCAGTACTCCCCGGGTGGCCAGGACACCCCCAGCTCCAGCTCCTCAGGGGACG
ACTCCGTGTTTGCCCACGACCTGCTGCCCCCGGCCCCACCCAGCAGTGGGGGCTCGCGGA
CGTGAAGGGCCACTGGTCCCCAACAATGTGAGGGGTCCCTAGCAGCCCACCCTGCTGCTG
GTGCACAGCCACTCCCCGGCATGAGACTCAGTGCAGATGGAGAGACAGCTACACAGAGCT
TTGGTCTGTGTGTGTGTGTGTGCGTGTGTGTGTGTGTGTGTGCACATCCGCGTGTGCCTG
TGTGCGTGCGCATCTTGCCTCCAGGTGCAGAGGTACCCTGGGTGTCCCCGCTGCTGTGCA
ACGGTCTCCTGACTGGTGCTGCAGCACCGAGGGGCCTTTGTTCTGGGGGGACCCAGTGCA
GAATGTAAGTGGGCCCACCCGGTGGGACCCCCGTGGGGCAGGGAGCTGGGCCCGACATGG
CTCCGGCCTCTGCCTTTGCACCACGGGACATCACAGGGTGGGCCTCGGCCCCTCCCACAC
CCAAAGCTGAGCCTGCAGGGAAGCCCCACATGTCCAGCACCTTGTGCCTGGGGTGTTAGT
GGCACCGCCTCCCCACCTCCAGGCTTTCCCACTTCCCACCCTGCCCCTCAGAGACTGAAA
TTACGGGTACCTGAAGATGGGAGCCTTTACCTTTTATGCAAAAGGTTTATTCCGGAAACT
AGTGTACATTTCTATAAATAGATGCTGTGTATATGGTATATATACATATATATATATAAC
ATATATGGAAGAGGAAAAGGCTGGTACAACGGAGGCCTGCGACCCTGGGGGCACAGGAGG
CAGGCATGGCCCTGGGCGGGGCGTGGGGGGGCGTGGAGGGAGGCCCCAGGGGGTCTCACC
CATGCAAGCAGAGGACCAGGGCCTTTTCTGGCACCGCAGTTTTGTTTTAAAACTGGACCT
GTATATTTGTAAAGCTATTTATGGGCCCCTGGCACTCTTGTTCCCACACCCCAACACTTC
CAGCATTTAGCTGGCCACATGGCGGAGAGTTTTAATTTTTAACTTATTGACAACCGAGAA
GGTTTATCCCGCCGATAGAGGGACGGCCAAGAATGTACGTCCAGCCTGCCCCGGAGCTGG
AGGATCCCCTCCAAGCCTAAAAGGTTGTTAATAGTTGGAGGTGATTCCAGTGAAGATATT
TTATTTCCTTTGTCCTTTTTCAGGAGAATTAGATTTCTATAGGATTTTTCTTTAGGAGAT
TTATTTTTTGGACTTCAAAGCAAGCTGGTATTTTCATACAAATTCTTCTAATTGCTGTGT
GTCCCAGGCAGGGAGACGGTTTCCAGGGAGGGGCCGGCCCTGTGTGCAGGTTCCGATGTT
ATTAGATGTTACAAGTTTATATATATCTATATATATAATTTATTGAGTTTTTACAAGATG
TATTTGTTGTAGACTTAACACTTCTTACGCAATGCTTCTAGAGTTTTATAGCCTGGACTG
CTACCTTTCAAAGCTTGGAGGGAAGCCGTGAATTCAGTTGGTTCGTTCTGTACTGTTACT
GGGCCCTGAGTCTGGGCAGCTGTCCCTTGCTTGCCTGCAGGGCCATGGCTCAGGGTGGTC
TCTTCTTGGGGCCCAGTGCATGGTGGCCAGAGGTGTCACCCAAACCGGCAGGTGCGATTT
TGTTAACCCAGCGACGAACTTTCCGAAAAATAAAGACACCTGGTTGCTAACCTGG

Protein Sequence

>2261 : length: 811
MGAPACALALCVAVAIVAGASSESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELS
CPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCH
FSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAG
NPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQT
YTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGP
DGTPYVTVLKSWISESVEADVRLRLANVSERDGGEYLCRATNFIGVAEKAFWLSVHGPRA
AEEELVEADEAGSVYAGILSYGVGFFLFILVVAAVTLCRLRSPPKKGLGSPTVHKISRFP
LKRQVTVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGK
PLGEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHK
NIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVS
CAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRL
PVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKP
ANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDQEYLDLSAPFEQYSPGGQ
DTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT