ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2255

Name

FGF10

Synonym

fibroblast growth factor 10;FGF10;fibroblast growth factor 10

Definition

FGF-10|keratinocyte growth factor 2|produced by fibroblasts of urinary bladder lamina propria

Position

5p13-p12

Gene Type

protein-coding

Pathways and Diseases

Pathway

Melanoma;KEGG PATHWAY;hsa05218

Pathway

Signaling by Insulin receptor;Reactome;REACT:498

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

Signaling by FGFR;Reactome;REACT:9470

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

FGF signaling pathway;PANTHER;P00021

Pathway

Regulation of gene expression in early pancreatic precursor cells;PID Reactome;500519

Disease

Pancreas cancer;FunDO

Disease

LADD syndrome;OMIM

Disease

Kidney disease;FunDO

Disease

Aplasia of lacrimal and salivary glands;OMIM

Disease

Bladder cancer;FunDO

External Links

Links to cell senescence gene database

2255

Links to epithelial mesenchymal transition gene database

2255

Links to ovarian cancer gene database

2255

Links to endometrial cancer gene database

2255

Links to iHOP

2255

Sequence Information

Nucleotide Sequence

>2255 : length: 3088
AGCAAAATTCGGAAAGCGGGAAGATACCGTCAGCGCCGTGGCCCGCGCTGCAAGCATAGG
ACGCTTTAGCAGCGAATTAGACAGAGCTAGAGGCGCCGGCGGAGGCTGCGGCCGCAACAG
CCGCGGCGAGGAAGGGACCTGGCAGCCCCCGAGCTCGGTGCAAAGGCATCGCGCTCTCTC
CTCGCTCCCCTGCTCCCCCACCCCCTTCTCTGCCCCTTTCACCCTCCCTCTCCCTGGCGT
TCCCAGCAGCCTAGGGTTTCAGATGTCCCACCGCCGGTTGACCCCCTCCCCCCTCTTCTC
CACCCCTGCAAATGAGGTTTGACCAGCAGAGGCAGAGCCCACCTCTGGCTTAGAATCACT
GACATTTAGACTCCAGGCTTCAACCTGTTTACAAGCGGACTTTCCAAAGGAAGGGGGTGG
GAGATAGGGCCATACAAAACACCAGCCGCCGTCCCCCAAAACAAAAAGTGACTTTCGGCA
GCCTTCAAATCGGCAGGCACCACTAAAAACAGAAAGGAAGAGAGGGAAGAAAACAACGGC
GACTGGGCAGCTGCCTCCACTTCTGACAACTCCAAAGGGATATACTTGTAGAAGTGGCTC
GCAGGCTGGGGCTCCGCAGAGAGAGACCAGAAGACCTTTTTGGCATCTAACATGGTGAAG
AAAGGAGTAAAGAAGAGAACAAAGTAACTCCTGGGGGAGCGAAGAGCGCTGGTGACCAAC
ACCACCAACGCCACCACCAGCTCCTGCTGCTGCGGCCACCCACGTCCACCATTTACCGGG
AGGCTCCAGAGGCGTAGGCAGCGGATCCGAGAAAGGAGCGAGGGGAGTCAGCCGGCTTTT
CCGAGGAGTTATGGATGTTGGTGCATTCACTTCTGGCCAGATCCGCGCCCAGAGGGAGCT
AACCAGCAGCCACCACCTCGAGCTCTCTCCTTGCCTTGCATCGGGTCTTACCCTTCCAGT
ATGTTCCTTCTGATGAGACAATTTCCAGTGCCGAGAGTTTCAGTACAATGTGGAAATGGA
TACTGACACATTGTGCCTCAGCCTTTCCCCACCTGCCCGGCTGCTGCTGCTGCTGCTTTT
TGTTGCTGTTCTTGGTGTCTTCCGTCCCTGTCACCTGCCAAGCCCTTGGTCAGGACATGG
TGTCACCAGAGGCCACCAACTCTTCTTCCTCCTCCTTCTCCTCTCCTTCCAGCGCGGGAA
GGCATGTGCGGAGCTACAATCACCTTCAAGGAGATGTCCGCTGGAGAAAGCTATTCTCTT
TCACCAAGTACTTTCTCAAGATTGAGAAGAACGGGAAGGTCAGCGGGACCAAGAAGGAGA
ACTGCCCGTACAGCATCCTGGAGATAACATCAGTAGAAATCGGAGTTGTTGCCGTCAAAG
CCATTAACAGCAACTATTACTTAGCCATGAACAAGAAGGGGAAACTCTATGGCTCAAAAG
AATTTAACAATGACTGTAAGCTGAAGGAGAGGATAGAGGAAAATGGATACAATACCTATG
CATCATTTAACTGGCAGCATAATGGGAGGCAAATGTATGTGGCATTGAATGGAAAAGGAG
CTCCAAGGAGAGGACAGAAAACACGAAGGAAAAACACCTCTGCTCACTTTCTTCCAATGG
TGGTACACTCATAGAGGAAGGCAACGTTTGTGGATGCAGTAGAACCAATGGCTCTTTTGC
CAAGAATAGTGGATATTCTTCATGAAGACAGTAGATTGAAAGGCAAAGACACGTTGCAGA
TGTCTGCTTGCTTAAAAGAAAGCCAGCCTTTGAAGGTTTTTGTATTCACTGCTGACATAT
GATGTTCTTTTAATTAGTTCTGTGTCATGTCTTATAATCAAGATATAGGCAGATCGAATG
GGATAGAAGTTATTCCCAAGTGAAAAACATTGTGGCTGGGTTTTTTGTTGTTGTTGTCAA
GTTTTTGTTTTTAAACCTCTGAGATAGAACTTAAAGGACATAGAACAATCTGTTGAAAGA
ACGATCTTCGGGAAAGTTATTTATGGAATACGAACTCATATCAAAGACTTCATTGCTCAT
TCAAGCCTAATGAATCAATGAACAGTAATACATGCAAGCATTTACTGGAAAGCACTTGGG
TCATATCATATGCACAACCAAAGGAGTTCTGGATGTGGTCTCATGGAATAATTGAATAGA
ATTTAAAAATATAAACATGTTAGTGTGAAACTGTTCTAACAATACAAATAGTATGGTATG
CTTGTGCATTCTGCCTTCATCCCTTTCTATTTCTTTCTAAGTTATTTATTTAATAGGATG
TTAAATATCTTTTGGGGTTTTAAAGAGTATCTCAGCAGCTGTCTTCTGATTTATCTTTTC
TTTTTATTCAGCACACCACATGCATGTTCACGACAAAGTGTTTTTAAAACTTGGCGAACA
CTTCAAAAATAGGAGTTGGGATTAGGGAAGCAGTATGAGTGCCCGTGTGCTATCAGTTGA
CTTAATTTGCACTTCTGCAGTAATAACCATCAACAATAAATATGGCAATGCTGTGCCATG
GCTTGAGTGAGAGATGTCTGCTATCATTTGAAAACATATATTACTCTCGAGGCTTCCTGT
CTCAAGAAATAGACCAGAAGGCCAAATTCTTCTCTTTCAATACATCAGTTTGCCTCCAAG
AATATACTAAAAAAAGGAAAATTAATTGCTAAATACATTTAAATAGCCTAGCCTCATTAT
TTACTCATGATTTCTTGCCAAATGTCATGGCGGTAAAGAGGCTGTCCACATCTCTAAAAA
CCCTCTGTAAATTCCACATAATGCATCTTTCCCAAAGGAACTATCAAAGAATTTGGTATG
AAGCGCAACTCTCCCAGGGGCTTAAACTGAGCAAATCAAATATATACTGGTATATGTGTA
ACCATATACAAAAACCTGTTCTAGCTGTATGATCTAGTCTTTACAAAACCAAATAAAACT
TGTTTTCTGTAAATTTAAAGAGCTTTACAAAGTTCCATAATGTAACCATATCAAAATTCA
TTTTGTTAGAGCAGGTATAGAAAAGAGTACATAAGAGTTTACCAATCATCATCACATTGT
ATTCCACTAAATAAATACATAAGCCTTA

Protein Sequence

>2255 : length: 208
MWKWILTHCASAFPHLPGCCCCCFLLLFLVSSVPVTCQALGQDMVSPEATNSSSSSFSSP
SSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGV
VAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVAL
NGKGAPRRGQKTRRKNTSAHFLPMVVHS