ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2253

Name

FGF8

Synonym

AIGF|FGF-8|HBGF-8|HH6|KAL6;fibroblast growth factor 8 (androgen-induced);FGF8;fibroblast growth factor 8 (androgen-induced)

Definition

androgen-induced growth factor|fibroblast growth factor 8|heparin-binding growth factor 8

Position

10q24

Gene Type

protein-coding

Pathways and Diseases

Pathway

Melanoma;KEGG PATHWAY;hsa05218

Pathway

Signaling by Insulin receptor;Reactome;REACT:498

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

Signaling by FGFR;Reactome;REACT:9470

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

FGF signaling pathway;PANTHER;P00021

Disease

Kallmann syndrome 6;OMIM

Disease

Prostate cancer;FunDO

Disease

Ovarian cancer;FunDO

Disease

Rheumatoid arthritis;FunDO

Disease

Bone metastases;FunDO

External Links

Links to cell senescence gene database

2253

Links to epithelial mesenchymal transition gene database

2253

Links to ovarian cancer gene database

2253

Links to endometrial cancer gene database

2253

Links to iHOP

2253

Sequence Information

Nucleotide Sequence

>2253 : length: 1036
ACCCGCACCCTCTCCGCTCGCGCCCTGCTCAGCGCGTCCTCCCGCGGCGGCCCGCGGGAC
GGCGTGACCCGCCGGGCTCTCGGTGCCCCGGGGCCGCGCGCCATGGGCAGCCCCCGCTCC
GCGCTGAGCTGCCTGCTGTTGCACTTGCTGGTCCTCTGCCTCCAAGCCCAGGAAGGCCCG
GGCAGGGGCCCTGCGCTGGGCAGGGAGCTCGCTTCCCTGTTCCGGGCTGGCCGGGAGCCC
CAGGGTGTCTCCCAACAGGTAACTGTTCAGTCCTCACCTAATTTTACACAGCATGTGAGG
GAGCAGAGCCTGGTGACGGATCAGCTCAGCCGCCGCCTCATCCGGACCTACCAACTCTAC
AGCCGCACCAGCGGGAAGCACGTGCAGGTCCTGGCCAACAAGCGCATCAACGCCATGGCA
GAGGACGGCGACCCCTTCGCAAAGCTCATCGTGGAGACGGACACCTTTGGAAGCAGAGTT
CGAGTCCGAGGAGCCGAGACGGGCCTCTACATCTGCATGAACAAGAAGGGGAAGCTGATC
GCCAAGAGCAACGGCAAAGGCAAGGACTGCGTCTTCACGGAGATTGTGCTGGAGAACAAC
TACACAGCGCTGCAGAATGCCAAGTACGAGGGCTGGTACATGGCCTTCACCCGCAAGGGC
CGGCCCCGCAAGGGCTCCAAGACGCGGCAGCACCAGCGTGAGGTCCACTTCATGAAGCGG
CTGCCCCGGGGCCACCACACCACCGAGCAGAGCCTGCGCTTCGAGTTCCTCAACTACCCG
CCCTTCACGCGCAGCCTGCGCGGCAGCCAGAGGACTTGGGCCCCCGAGCCCCGATAGGTG
CTGCCTGGCCCTCCCCACAATGCCAGACCGCAGAGAGGCTCATCCTGTAGGGCACCCAAA
ACTCAAGCAAGATGAGCTGTGCGCTGCTCTGCAGGCTGGGGAGGTGCTGGGGGAGCCCTG
GGTTCCGGTTGTTGATATTGTTTGCTGTTGGGTTTTTGCTGTTTTTTTTTTTTTTTTTTT
TTTTAAAACAAAAGAG

Protein Sequence

>2253 : length: 244
MGSPRSALSCLLLHLLVLCLQAQEGPGRGPALGRELASLFRAGREPQGVSQQVTVQSSPN
FTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETD
TFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYM
AFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWA
PEPR