ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2249

Name

FGF4

Synonym

HBGF-4|HST|HST-1|HSTF1|K-FGF|KFGF;fibroblast growth factor 4;FGF4;fibroblast growth factor 4

Definition

FGF-4|HSTF-1|fibroblast growth factor 4 splice isoform|heparin secretory transforming protein 1|heparin secretory-transforming protein 1|heparin-binding growth factor 4|human stomach cancer, transforming factor from FGF-related oncogene|kaposi sarcoma onc

Position

11q13.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Melanoma;KEGG PATHWAY;hsa05218

Pathway

Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106

Pathway

Signaling by Insulin receptor;Reactome;REACT:498

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

Signaling by FGFR;Reactome;REACT:9470

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

FGF signaling pathway;PANTHER;P00021

Disease

Leukemia;FunDO

Disease

Breast cancer;FunDO

Disease

Testicular dysfunction;FunDO

External Links

Links to cell senescence gene database

2249

Links to epithelial mesenchymal transition gene database

2249

Links to ovarian cancer gene database

2249

Links to endometrial cancer gene database

2249

Links to iHOP

2249

Sequence Information

Nucleotide Sequence

>2249 : length: 2032
ATGTCGGGGCCCGGGACGGCCGCGGTAGCGCTGCTCCCGGCGGTCCTGCTGGCCTTGCTG
GCGCCCTGGGCGGGCCGAGGGGGCGCCGCCGCACCCACTGCACCCAACGGCACGCTGGAG
GCCGAGCTGGAGCGCCGCTGGGAGAGCCTGGTGGCGCTCTCGTTGGCGCGCCTGCCGGTG
GCAGCGCAGCCCAAGGAGGCGGCCGTCCAGAGCGGCGCCGGCGACTACCTGCTGGGCATC
AAGCGGCTGCGGCGGCTCTACTGCAACGTGGGCATCGGCTTCCACCTCCAGGCGCTCCCC
GACGGCCGCATCGGCGGCGCGCACGCGGACACCCGCGACAGCCTGCTGGAGCTCTCGCCC
GTGGAGCGGGGCGTGGTGAGCATCTTCGGCGTGGCCAGCCGGTTCTTCGTGGCCATGAGC
AGCAAGGGCAAGCTCTATGGCTCGCCCTTCTTCACCGATGAGTGCACGTTCAAGGAGATT
CTCCTTCCCAACAACTACAACGCCTACGAGTCCTACAAGTACCCCGGCATGTTCATCGCC
CTGAGCAAGAATGGGAAGACCAAGAAGGGGAACCGAGTGTCGCCCACCATGAAGGTCACC
CACTTCCTCCCCAGGCTGTGACCCTCCAGAGGACCCTTGCCTCAGCCTCGGGAAGCCCCT
GGGAGGGCAGTGCCGAGGGTCACCTTGGTGCACTTTCTTCGGATGAAGAGTTTAATGCAA
GAGTGTGCACGCCCACTGGTGAGCATCTGATCCATGCTCTGGCCCCAGCCAAAGAGGAGA
CCCCAAGCCAGTTCCAGCCATCCAGTCAGTGACCCAGCACACGTAGCAGCCACATCCGGT
TGGCCGATGGGAAGCAGAACAACACCGGCTCAGGAGGACAAGCTTCAGTGGAAAAACATT
GTCCCTTGTCATACACAGAAGGTAGCCCATGATAAGAAACACAAAATGATGTTGAGAATT
TCTTGCAAGATGCAGGTGTCTGCCAAAAGCTCTGAGCCTCGGGCTTGCTGTCTCTTTTTC
TCCCCCCACAAGAGAGATTTGCAAGTGTTAGAGGGGTGTTAAGGACTTACTGTCACCAAA
CAGAGACATTCTCCTGGGAGTGAGAATGGCTGAAAGGGAATAGCTTTCTCACTGGGCGAT
CCAATGTGACTTAATGTAACCAACCCATGTTCCACCTAGAAATGCCTCTCCTGCTACAGG
CCAGTGTGGCACCTGGGGCAGCACCCTGTTAATCCATAGAAAGGGTTCAGCACAACCCCA
GGCCGGCGAGTGCTCACAAGGGTGAGCTGTGATTTCAGTGACTCCTATGGCTCGTTGGAC
GCCACTGTGGACACAGTGAGGCAGCGGAGGCTATCTTCCCAGACAAAGCAGTGGCAGGTC
CCTGCAGGACCTCCCAAGGCATCTGACCCAGGAGATAAATTGCATTTGGCAAGAGACCTC
ATATCTTCAAAGGGCTCCCTGTCACCAGGGCCACTCACAGCACCTCAGTCGACCAGAGAC
CCTGCAGCCCTGGGCCGTCCCAGAGCACCCCACTTAGGACTTGCTTGCACGTGGCTCTCT
GCAAATGTCAGACTCCTGACAAAATGATAGACAAAGCTAAGTGGTGGTGACGTCTTTGAC
TGTCCTCTCACTGAGAGGTGGGTGCCTATGTCCCTTCCTCTTCAGTCTGAGTGGGCTTCT
AACTGCTTCCACCAGTAGCATTGGCAGAAGTGCCACAGTGTGATTTCTGAGGCTGGGTCA
CCACAGGTGATGCTTGGAGCCCTGAGCCACTGTGTCAGGTTCATACCTGAGGAGGCCATA
CTGGGAGGAAGCCCAAGCCACACAGAGATCAGAAGTCCAACCACCTGAAGACGCCATACT
GGGAGGAAGCCCAAGCTGCACAGAGAGGCCAAGTGTAGGTGTTCCGGCCAGTCCTAGCTA
GATCTGGACTTCAAATTGTCCCGACCCAGACATCATACATGTGAAGAGGCCTCCAGGATG
GTCCCAGTTCCCATCCATTTGAGTCTTCCCAGCTGAAATTCCAGATGTCATG

Protein Sequence

>2249 : length: 206
MSGPGTAAVALLPAVLLALLAPWAGRGGAAAPTAPNGTLEAELERRWESLVALSLARLPV
AAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSP
VERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIA
LSKNGKTKKGNRVSPTMKVTHFLPRL