ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2248

Name

FGF3

Synonym

HBGF-3|INT2;fibroblast growth factor 3;FGF3;fibroblast growth factor 3

Definition

FGF-3|INT-2 proto-oncogene protein|V-INT2 murine mammary tumor virus integration site oncogene homolog|fibroblast growth factor 3 (murine mammary tumor virus integration site (v-int-2) oncogene homolog)|heparin-binding growth factor 3|murine mammary tumor

Position

11q13

Gene Type

protein-coding

Pathways and Diseases

Pathway

Melanoma;KEGG PATHWAY;hsa05218

Pathway

Signaling by Insulin receptor;Reactome;REACT:498

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

Signaling by FGFR;Reactome;REACT:9470

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

FGF signaling pathway;PANTHER;P00021

Disease

Protein quantitative trait loci;NHGRI

Disease

Kaposi's sarcoma;KEGG DISEASE;H00041

Disease

protein quantitative trait loci;GAD

Disease

Infections caused by dsDNA viruses;KEGG DISEASE

Disease

Viral infections;KEGG DISEASE

Disease

Deafness, congenital with inner ear agenesis, microtia, and microdontia;OMIM

External Links

Links to cell senescence gene database

2248

Links to epithelial mesenchymal transition gene database

2248

Links to ovarian cancer gene database

2248

Links to endometrial cancer gene database

2248

Links to iHOP

2248

Sequence Information

Nucleotide Sequence

>2248 : length: 1548
GACCTTTCAGAGCCAGGAGGGCTTTCGGGGGCGTGGGGCGCGCTGCGGAGCGGAGCCGCG
GCTCGACGGCGGTGCGCTGGCGGCGAGTGTATGCAGACGGCGCCCGGCCCGAACCCCGAG
CCCCGCGGGGCTCCCCACCCGCCGGCCTCCCGCCCCTCCCGCGCCTCCGCCTGGGGACCA
CGTCGGCCTTTTGTTGGCGAACCGTCCTTTCTTTCAGCGCTTTGCGCAGCAACGGAAATT
TCATTGCTCCTGGGTGGAAATTAAAGGGACTCGCGTTCCCTCTCTCCCTCTCCCTCTCCC
ACTCTCCCTCTCTTTCTCTCTCTCGCCCACCCTTCCCCCTTCTTCCCCCACCTTTCCCGC
GAAGCCGGAGTCAGCATCTCCAGGCGCGGGATCCCGCTCCGAGCACCTCGCAGCTGTCCG
GCTGCCGCCCCTTCCATGGGCGCCGCGCTCGCCTGCAGCCGCCGCCGCCGCGGGGCGGGC
GCGATGCCACGATGGGCCTAATCTGGCTGCTACTGCTCAGCCTGCTGGAGCCCGGCTGGC
CCGCAGCGGGCCCTGGGGCGCGGTTGCGGCGCGATGCGGGCGGCCGTGGCGGCGTCTACG
AGCACCTTGGCGGGGCGCCCCGGCGCCGCAAGCTCTACTGCGCCACGAAGTACCACCTCC
AGCTGCACCCGAGCGGCCGCGTCAACGGCAGCCTGGAGAACAGCGCCTACAGTATTTTGG
AGATAACGGCAGTGGAGGTGGGCATTGTGGCCATCAGGGGTCTCTTCTCCGGGCGGTACC
TGGCCATGAACAAGAGGGGACGACTCTATGCTTCGGAGCACTACAGCGCCGAGTGCGAGT
TTGTGGAGCGGATCCACGAGCTGGGCTATAATACGTATGCCTCCCGGCTGTACCGGACGG
TGTCTAGTACGCCTGGGGCCCGCCGGCAGCCCAGCGCCGAGAGACTGTGGTACGTGTCTG
TGAACGGCAAGGGCCGGCCCCGCAGGGGCTTCAAGACCCGCCGCACACAGAAGTCCTCCC
TGTTCCTGCCCCGCGTGCTGGACCACAGGGACCACGAGATGGTGCGGCAGCTACAGAGTG
GGCTGCCCAGACCCCCTGGTAAGGGGGTCCAGCCCCGACGGCGGCGGCAGAAGCAGAGCC
CGGATAACCTGGAGCCCTCTCACGTTCAGGCTTCGAGACTGGGCTCCCAGCTGGAGGCCA
GTGCGCACTAGCTGGGCCTGGTGGCCACCGCCAGAGCTCCTGGCGACATCTTGGCGTGGC
AGCCTCTTGACTCTGACTCTCCTCCTTGAGCCCTTGCCCCTGCGTCCCGCGTCTGGGTTC
TCAGCTATTTCCAGAGCCAGCTCAAATCAGGGTCCAGTGGGAACTGAAGAGGGCCCAAGT
CGGAGCTCGGAGGGGGCTGCCTGCAATGCAGGGCATTTGTGGGTCTGTGTGGCAGGAAGC
CGGCAGGGAAGGGCCTGAGTGCCAGCCCTGGCAGACTGAGGAGCCTCCCAGGAGCAGCGG
GGCAGTGTGGGGCTTTGTGTCATCACAACATTAAAGTATTTTATTCTA

Protein Sequence

>2248 : length: 239
MGLIWLLLLSLLEPGWPAAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHP
SGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMNKRGRLYASEHYSAECEFVER
IHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLP
RVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPDNLEPSHVQASRLGSQLEASAH