ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2242

Name

FES

Synonym

FPS;FES proto-oncogene, tyrosine kinase;FES;FES proto-oncogene, tyrosine kinase

Definition

Oncogene FES, feline sarcoma virus|feline sarcoma (Snyder-Theilen) viral (v-fes)/Fujinami avian sarcoma (PRCII) viral (v-fps) oncogene homolog|feline sarcoma oncogene|feline sarcoma/Fujinami avian sarcoma oncogene homolog|p93c-fes|proto-oncogene c-Fes|pro

Position

15q26.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Axon guidance mediated by semaphorins;PANTHER;P00007

Pathway

Angiopoietin receptor Tie2-mediated signaling;PID Curated;200066

Pathway

IL4-mediated signaling events;PID Curated;200018

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161

Pathway

Axon guidance;KEGG PATHWAY;hsa04360

Pathway

SEMA3A-Plexin repulsion signaling by inhibiting Integrin adhesion;PID Reactome;500075

Disease

Colon cancer;FunDO

Disease

Sarcoma;FunDO

External Links

Links to cell senescence gene database

2242

Links to epithelial mesenchymal transition gene database

2242

Links to ovarian cancer gene database

2242

Links to endometrial cancer gene database

2242

Links to iHOP

2242

Sequence Information

Nucleotide Sequence

>2242 : length: 2918
ATCAGGAACTGGCCGGGGTCCGCACCGGGCCTGAGTCGGTCCGAGGCCGTCCCAGGAGCA
GCTGCCCGTGCGGGTACCTCTAGCCCCGGGGCCTGGAGGAGCGGTGGGAGCTGGGGGCGC
GGCAGGCAGGGGCAGAGCAGGCGTTCCGAGGGCCAGAGACCCACCCAGAACAGCACTATG
GGCTTCTCTTCCGAGCTGTGCAGCCCCCAGGGCCACGGGGTCCTGCAGCAAATGCAGGAG
GCCGAGCTTCGTCTACTGGAGGGCATGAGAAAGTGGATGGCCCAGCGGGTCAAGAGTGAC
AGGGAGTATGCAGGACTGCTTCACCACATGTCCCTGCAGGACAGTGGGGGCCAGAGCCGG
GCCATCAGCCCTGACAGCCCCATCAGTCAGTCCTGGGCTGAGATCACCAGCCAAACTGAG
GGCCTGAGCCGCTTGCTGCGGCAGCACGCAGAGGATCTGAACTCAGGGCCCCTGAGCAAG
CTGAGCCTGCTCATCCGGGAACGGCAGCAGCTTCGCAAGACCTACAGCGAGCAGTGGCAG
CAGCTGCAGCAGGAGCTCACCAAGACCCACAGCCAGGACATTGAGAAGCTGAAGAGCCAG
TACCGAGCTCTGGCACGGGACAGTGCCCAAGCCAAGCGCAAGTACCAGGAGGCCAGCAAA
GACAAGGACCGTGACAAGGCTAAGGACAAGTATGTGCGCAGCCTGTGGAAGCTCTTTGCT
CACCACAACCGCTATGTGCTGGGCGTGCGGGCTGCGCAGCTACACCACCAGCACCACCAC
CAGCTCCTGCTGCCCGGCCTGCTGCGGTCACTGCAGGACCTGCACGAGGAGATGGCTTGC
ATCCTGAAGGAGATCCTGCAGGAATACCTGGAGATTAGCAGCCTGGTGCAGGATGAGGTG
GTGGCCATTCACCGGGAGATGGCTGCAGCTGCTGCCCGCATCCAGCCTGAGGCTGAGTAC
CAAGGCTTCCTGCGACAGTATGGGTCCGCACCTGACGTCCCACCCTGTGTCACGTTCGAT
GAGTCACTGCTTGAGGAGGGTGAACCGCTGGAGCCTGGGGAGCTCCAGCTGAACGAGCTG
ACTGTGGAGAGCGTGCAGCACACGCTGACCTCAGTGACAGATGAGCTGGCTGTGGCCACC
GAGATGGTGTTCAGGCGGCAGGAGATGGTTACGCAGCTGCAACAGGAGCTCCGGAATGAA
GAGGAGAACACCCACCCCCGGGAGCGGGTGCAGCTGCTGGGCAAGAGGCAAGTGCTGCAA
GAAGCACTGCAGGGGCTGCAGGTAGCGCTGTGCAGCCAGGCCAAGCTGCAGGCCCAGCAG
GAGTTGCTGCAGACCAAGCTGGAGCACCTGGGCCCCGGCGAGCCCCCGCCTGTGCTGCTC
CTGCAGGATGACCGCCACTCCACGTCGTCCTCGGAGCAGGAGCGAGAGGGGGGAAGGACA
CCCACGCTGGAGATCCTTAAGAGCCACATCTCAGGAATCTTCCGCCCCAAGTTCTCGCTC
CCTCCACCGCTGCAGCTCATTCCGGAGGTGCAGAAGCCCCTGCATGAGCAGCTGTGGTAC
CACGGGGCCATCCCGAGGGCAGAGGTGGCTGAGCTGCTGGTGCACTCTGGGGACTTCCTG
GTGCGGGAGAGCCAGGGCAAGCAGGAGTACGTGCTGTCGGTGCTGTGGGATGGTCTGCCC
CGGCACTTCATCATCCAGTCCTTGGATGGCTCACGCCCCCTCAGAATGGAGGCTGCTGAC
CCCGGGTCCCCTGCCCTGCAGAACCTGTACCGACTGGAAGGGGAAGGCTTTCCTAGCATT
CCTTTGCTCATCGACCACCTACTGAGCACCCAGCAGCCCCTCACCAAGAAGAGTGGTGTT
GTCCTGCACAGGGCTGTGCCCAAGGACAAGTGGGTGCTGAACCATGAGGACCTGGTGTTG
GGTGAGCAGATTGGACGGGGGAACTTTGGCGAAGTGTTCAGCGGACGCCTGCGAGCCGAC
AACACCCTGGTGGCGGTGAAGTCTTGTCGAGAGACGCTCCCACCTGACCTCAAGGCCAAG
TTTCTACAGGAAGCGAGGATCCTGAAGCAGTACAGCCACCCCAACATCGTGCGTCTCATT
GGTGTCTGCACCCAGAAGCAGCCCATCTACATCGTCATGGAGCTTGTGCAGGGGGGCGAC
TTCCTGACCTTCCTCCGCACGGAGGGGGCCCGCCTGCGGGTGAAGACTCTGCTGCAGATG
GTGGGGGATGCAGCTGCTGGCATGGAGTACCTGGAGAGCAAGTGCTGCATCCACCGGGAC
CTGGCTGCTCGGAACTGCCTGGTGACAGAGAAGAATGTCCTGAAGATCAGTGACTTTGGG
ATGTCCCGAGAGGAAGCCGATGGGGTCTATGCAGCCTCAGGGGGCCTCAGACAAGTCCCC
GTGAAGTGGACCGCACCTGAGGCCCTTAACTACGGCCGCTACTCCTCCGAAAGCGACGTG
TGGAGCTTTGGCATCTTGCTCTGGGAGACCTTCAGCCTGGGGGCCTCCCCCTATCCCAAC
CTCAGCAATCAGCAGACACGGGAGTTTGTGGAGAAGGGGGGCCGTCTGCCCTGCCCAGAG
CTGTGTCCTGATGCCGTGTTCAGGCTCATGGAGCAGTGCTGGGCCTATGAGCCTGGGCAG
CGGCCCAGCTTCAGCACCATCTACCAGGAGCTGCAGAGCATCCGAAAGCGGCATCGGTGA
GGCTGGGACCCCCTTCTCAAGCTGGTGGCCTCTGCAGGCCTAGGTGCAGCTCCTCAGCGG
CTCCAGCTCATATGCTGACAGCTCTTCACAGTCCTGGACTCCTGCCACCAGCATCCACAC
TGCCGGCAGGATGCAGCGCCGTGTCCTCTCTGTGTCCCTGCTGCTGCCAGGGCTTCCTCT
TCCGGGCAGAAACAATAAAACCACTTGTGCCCACTGAA

Protein Sequence

>2242 : length: 840
MGFSSELCSPQGHGVLQQMQEAELRLLEGMRKWMAQRVKSDREYAGLLHHMSLQDSGGQS
RAISPDSPISQSWAEITSQTEGLSRLLRQHAEDLNSGPLSKLSLLIRERQQLRKTYSEQW
QQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLF
AHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDE
VVAIHREMAAAAARIQPEAEYQGFLRQYGSAPDVPPCVTFDESLLEEGEPLEPGELQLNE
LTVESVQHTLTSVTDELAVATEMVFRRQEMVTQLQQELRNEEENTHPRERVQLLGKRQVL
QEALQGLQVALCSQAKLQAQQELLQTKLEHLGPGEPPPVLLLQDDRHSTSSSEQEREGGR
TPTLEILKSHISGIFRPKFSLPPPLQLIPEVQKPLHEQLWYHGAIPRAEVAELLVHSGDF
LVRESQGKQEYVLSVLWDGLPRHFIIQSLDGSRPLRMEAADPGSPALQNLYRLEGEGFPS
IPLLIDHLLSTQQPLTKKSGVVLHRAVPKDKWVLNHEDLVLGEQIGRGNFGEVFSGRLRA
DNTLVAVKSCRETLPPDLKAKFLQEARILKQYSHPNIVRLIGVCTQKQPIYIVMELVQGG
DFLTFLRTEGARLRVKTLLQMVGDAAAGMEYLESKCCIHRDLAARNCLVTEKNVLKISDF
GMSREEADGVYAASGGLRQVPVKWTAPEALNYGRYSSESDVWSFGILLWETFSLGASPYP
NLSNQQTREFVEKGGRLPCPELCPDAVFRLMEQCWAYEPGQRPSFSTIYQELQSIRKRHR