ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2224

Name

FDPS

Synonym

FPPS|FPS;farnesyl diphosphate synthase;FDPS;farnesyl diphosphate synthase

Definition

(2E,6E)-farnesyl diphosphate synthase|FPP synthase|FPP synthetase|dimethylallyltranstransferase|farnesyl pyrophosphate synthase|farnesyl pyrophosphate synthetase, dimethylallyltranstransferase, geranyltranstransferase|geranyltranstransferase

Position

1q22

Gene Type

protein-coding

Pathways and Diseases

Pathway

superpathway of cholesterol biosynthesis;BioCyc;PWY66-5

Pathway

Metabolic pathways;KEGG PATHWAY;hsa01100

Pathway

trans,trans-farnesyl diphosphate biosynthesis;BioCyc;PWY-5123

Pathway

Cholesterol biosynthesis;PANTHER;P00014

Pathway

Terpenoid backbone biosynthesis;KEGG PATHWAY;hsa00900

Pathway

superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate);BioCyc;PWY-5910

Disease

Colon cancer;FunDO

Disease

Osteosarcoma;FunDO

External Links

Links to cell senescence gene database

2224

Links to epithelial mesenchymal transition gene database

2224

Links to ovarian cancer gene database

2224

Links to endometrial cancer gene database

2224

Links to iHOP

2224

Sequence Information

Nucleotide Sequence

>2224 : length: 1555
TCAGCGCGGCTCATCTTCGCCCAGCCAGGACACGCAGGATCGCGTTATCTGTCCCTCCCG
CGGGCACATTGGGAGTTGTAGTCTAATTATATATTTCCGCCCTTAGTGTGGGGAGAGCGG
GAACTACTCGACCCACAGAGCCGATCGCGGAGCGGATTCTGCTTTTAGGAGTACCCGCCA
ACAAGCGGGACCGAGCAGGAATCCGTATCTGGGAACAGGATGCCCCTGTCCCGCTGGTTG
AGATCTGTGGGGGTCTTCCTGCTGCCAGCCCCCTACTGGGCACCCCGGGAGAGGTGGCTG
GGTTCCCTACGGCGGCCCTCCCTGGTGCACGGGTACCCAGTCCTGGCCTGGCACAGTGCC
CGCTGCTGGTGCCAAGCGTGGACAGAGGAACCTCGAGCCCTTTGCTCCTCCCTCAGAATG
AACGGAGACCAGAATTCAGATGTTTATGCCCAAGAAAAGCAGGATTTCGTTCAGCACTTC
TCCCAGATCGTTAGGGTGCTGACTGAGGATGAGATGGGGCACCCAGAGATAGGAGATGCT
ATTGCCCGGCTCAAGGAGGTCCTGGAGTACAATGCCATTGGAGGCAAGTATAACCGGGGT
TTGACGGTGGTAGTAGCATTCCGGGAGCTGGTGGAGCCAAGGAAACAGGATGCTGATAGT
CTCCAGCGGGCCTGGACTGTGGGCTGGTGTGTGGAACTGCTGCAAGCTTTCTTCCTGGTG
GCAGATGACATCATGGATTCATCCCTTACCCGCCGGGGACAGATCTGCTGGTATCAGAAG
CCGGGCGTGGGTTTGGATGCCATCAATGATGCTAACCTCCTGGAAGCATGTATCTACCGC
CTGCTGAAGCTCTATTGCCGGGAGCAGCCCTATTACCTGAACCTGATCGAGCTCTTCCTG
CAGAGTTCCTATCAGACTGAGATTGGGCAGACCCTGGACCTCCTCACAGCCCCCCAGGGC
AATGTGGATCTTGTCAGATTCACTGAAAAGAGGTACAAATCTATTGTCAAGTACAAGACA
GCTTTCTACTCCTTCTACCTTCCTATAGCTGCAGCCATGTACATGGCAGGAATTGATGGC
GAGAAGGAGCACGCCAATGCCAAGAAGATCCTGCTGGAGATGGGGGAGTTCTTTCAGATT
CAGGATGATTACCTTGACCTCTTTGGGGACCCCAGTGTGACCGGCAAAATTGGCACTGAC
ATCCAGGACAACAAATGCAGCTGGCTGGTGGTTCAGTGTCTGCAACGGGCCACTCCAGAA
CAGTACCAGATCCTGAAGGAAAATTACGGGCAGAAGGAGGCTGAGAAAGTGGCCCGGGTG
AAGGCGCTATATGAGGAGCTGGATCTGCCAGCAGTGTTCTTGCAATATGAGGAAGACAGT
TACAGCCACATTATGGCTCTCATTGAACAGTACGCAGCACCCCTGCCCCCAGCCGTCTTT
CTGGGGCTTGCGCGCAAAATCTACAAGCGGAGAAAGTGACCTAGAGATTGCAAGGGCGGG
GAGAGGAGGCTCTCAATAAATAATCGTGTAACCTTCAAAAAAAAAAAAAAAAAAA

Protein Sequence

>2224 : length: 419
MPLSRWLRSVGVFLLPAPYWAPRERWLGSLRRPSLVHGYPVLAWHSARCWCQAWTEEPRA
LCSSLRMNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAI
GGKYNRGLTVVVAFRELVEPRKQDADSLQRAWTVGWCVELLQAFFLVADDIMDSSLTRRG
QICWYQKPGVGLDAINDANLLEACIYRLLKLYCREQPYYLNLIELFLQSSYQTEIGQTLD
LLTAPQGNVDLVRFTEKRYKSIVKYKTAFYSFYLPIAAAMYMAGIDGEKEHANAKKILLE
MGEFFQIQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKE
AEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK