ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2185

Name

PTK2B

Synonym

CADTK|CAKB|FADK2|FAK2|PKB|PTK|PYK2|RAFTK;protein tyrosine kinase 2 beta;PTK2B;protein tyrosine kinase 2 beta

Definition

CAK-beta|FADK 2|PTK2B protein tyrosine kinase 2 beta|calcium-dependent tyrosine kinase|calcium-regulated non-receptor proline-rich tyrosine kinase|cell adhesion kinase beta|focal adhesion kinase 2|proline-rich tyrosine kinase 2|protein kinase B|protein-ty

Position

8p21.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Cell junction organization;Reactome;REACT:20676

Pathway

Calcium signaling pathway;KEGG PATHWAY;hsa04020

Pathway

thrombin signaling and protease-activated receptors;PID BioCarta;100082

Pathway

Alpha-synuclein signaling;PID Curated;200187

Pathway

CXCR4-mediated signaling events;PID Curated;200083

Pathway

il-7 signal transduction;PID BioCarta;100125

Pathway

LPA receptor mediated events;PID Curated;200011

Pathway

calcium signaling by hbx of hepatitis b virus;PID BioCarta;100150

Pathway

Osteopontin-mediated events;PID Curated;200042

Pathway

Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670

Pathway

Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031

Pathway

Interactions of the immunoglobulin superfamily (IgSF) member proteins;Reactome;REACT:23853

Pathway

Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161

Pathway

bioactive peptide induced signaling pathway;PID BioCarta;100226

Pathway

IL2-mediated signaling events;PID Curated;200082

Pathway

Endothelins;PID Curated;200004

Pathway

links between pyk2 and map kinases;PID BioCarta;100057

Pathway

angiotensin ii mediated activation of jnk pathway via pyk2 dependent signaling;PID BioCarta;100236

Pathway

Integrin signalling pathway;PANTHER;P00034

Pathway

GnRH signaling pathway;KEGG PATHWAY;hsa04912

Pathway

Integrins in angiogenesis;PID Curated;200109

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

role of nicotinic acetylcholine receptors in the regulation of apoptosis;PID BioCarta;100255

Pathway

Coregulation of Androgen receptor activity;PID Curated;200038

Pathway

Natural killer cell mediated cytotoxicity;KEGG PATHWAY;hsa04650

Pathway

FGF signaling pathway;PID Curated;200189

Disease

Hypertension;FunDO

Disease

Osteoporosis;FunDO

Disease

Nervous system tumor;FunDO

Disease

Prostate cancer;FunDO

External Links

Links to cell senescence gene database

2185

Links to epithelial mesenchymal transition gene database

2185

Links to ovarian cancer gene database

2185

Links to endometrial cancer gene database

2185

Links to iHOP

2185

Sequence Information

Nucleotide Sequence

>2185 : length: 4748
GCAGTTCCCGCCTCCTCAGGTCCGGGCGGGTCCCTGGCCGGGGTAGCACGGAAGGGTCTC
CCAGGCGGCGTAGTAGGGCTTCCGTGTTACTGGAAACCTACTTCCGGCTGCAAATGGGAA
AAGGAGCCTCTACCTTAACCAATCCCCGGGAACCTCAGGCCCGCGGATGGGAGAAACCAG
AGATGCCAACTTCCTGCTTCCGAAGTAGTGGCTGGGTCTTAAAGCACCGATGTTTCTGCA
TTGAATAGCCCTGGAAGACAGAATTCTTGTCTCTCCAAAGATCTGGCAGACTTATTCCCA
ATTATAAGAGATCCTTGCAAAGGAGGTGTCTTGCTTCACCTTCACCTTCCACTGTGATTG
TAAGTTTTCTGAGGCCTCGCCAGCCATGCGGAACTGAATAGGACTAGCAACTTCATAGAC
GGTTGTGAAGACAAGCTAGACGGCAGATGAAAGTTCTTGGCACAGAGTGAACACTTGATA
AACTATATGGCAGGGAGGGCTGGAACGGGGCTTGTTTGAAGAGCAATATGAGCCAGGGTT
ATAGACCTGAGTTTGGGGTAAGAGTGGAACATCCAAATGGAAGAGTCCAGCAGCTGAAAG
GACATTTGTTCAAAGGCCTTTTTCATTACAGTTTTCTCCTTCTTCTGATCCAGCCACAGC
CTCCGGAGCCGTTGCACACCTACCTGCCCGGCCGACTTACCTGTACTTGCCGCCGTCCCG
GCTCACCTGGCGGTGCCCGAGGAGTAGTCGCTGGAGTCCGCGCCTCCCTGGGACTGCAAT
GTGCCGATCTTAGCTGCTGCCTGAGAGGATGTCTGGGGTGTCCGAGCCCCTGAGTCGAGT
AAAGTTGGGCACGTTACGCCGGCCTGAAGGCCCTGCAGAGCCCATGGTGGTGGTACCAGT
AGATGTGGAAAAGGAGGACGTGCGTATCCTCAAGGTCTGCTTCTATAGCAACAGCTTCAA
TCCTGGGAAAAACTTCAAACTGGTCAAATGCACTGTCCAGACGGAGATCCGGGAGATCAT
CACCTCCATCCTGCTGAGCGGGCGGATCGGGCCCAACATCCGGTTGGCTGAGTGCTATGG
GCTGAGGCTGAAGCACATGAAGTCCGATGAGATCCACTGGCTGCACCCACAGATGACGGT
GGGTGAGGTGCAGGACAAGTATGAGTGTCTGCACGTGGAAGCCGAGTGGAGGTATGACCT
TCAAATCCGCTACTTGCCAGAAGACTTCATGGAGAGCCTGAAGGAGGACAGGACCACGCT
GCTCTATTTTTACCAACAGCTCCGGAACGACTACATGCAGCGCTACGCCAGCAAGGTCAG
CGAGGGCATGGCCCTGCAGCTGGGCTGCCTGGAGCTCAGGCGGTTCTTCAAGGATATGCC
CCACAATGCACTTGACAAGAAGTCCAACTTCGAGCTCCTAGAAAAGGAAGTGGGGCTGGA
CTTGTTTTTCCCAAAGCAGATGCAGGAGAACTTAAAGCCCAAACAGTTCCGGAAGATGAT
CCAGCAGACCTTCCAGCAGTACGCCTCGCTCAGGGAGGAGGAGTGCGTCATGAAGTTCTT
CAACACTCTCGCCGGCTTCGCCAACATCGACCAGGAGACCTACCGCTGTGAACTCATTCA
AGGATGGAACATTACTGTGGACCTGGTCATTGGCCCTAAAGGGATCCGCCAGCTGACTAG
TCAGGACGCAAAGCCCACCTGCCTGGCCGAGTTCAAGCAGATCAGGTCCATCAGGTGCCT
CCCGCTGGAGGAGGGCCAGGCAGTACTTCAGCTGGGCATTGAAGGTGCCCCCCAGGCCTT
GTCCATCAAAACCTCATCCCTAGCAGAGGCTGAGAACATGGCTGACCTCATAGACGGCTA
CTGCCGGCTGCAGGGTGAGCACCAAGGCTCTCTCATCATCCATCCTAGGAAAGATGGTGA
GAAGCGGAACAGCCTGCCCCAGATCCCCATGCTAAACCTGGAGGCCCGGCGGTCCCACCT
CTCAGAGAGCTGCAGCATAGAGTCAGACATCTACGCAGAGATTCCCGACGAAACCCTGCG
AAGGCCCGGAGGTCCACAGTATGGCATTGCCCGTGAAGATGTGGTCCTGAATCGTATTCT
TGGGGAAGGCTTTTTTGGGGAGGTCTATGAAGGTGTCTACACAAATCACAAAGGGGAGAA
AATCAATGTAGCTGTCAAGACCTGCAAGAAAGACTGCACTCTGGACAACAAGGAGAAGTT
CATGAGCGAGGCAGTGATCATGAAGAACCTCGACCACCCGCACATCGTGAAGCTGATCGG
CATCATTGAAGAGGAGCCCACCTGGATCATCATGGAATTGTATCCCTATGGGGAGCTGGG
CCACTACCTGGAGCGGAACAAGAACTCCCTGAAGGTGCTCACCCTCGTGCTGTACTCACT
GCAGATATGCAAAGCCATGGCCTACCTGGAGAGCATCAACTGCGTGCACAGGGACATTGC
TGTCCGGAACATCCTGGTGGCCTCCCCTGAGTGTGTGAAGCTGGGGGACTTTGGTCTTTC
CCGGTACATTGAGGACGAGGACTATTACAAAGCCTCTGTGACTCGTCTCCCCATCAAATG
GATGTCCCCAGAGTCCATTAACTTCCGACGCTTCACGACAGCCAGTGACGTCTGGATGTT
CGCCGTGTGCATGTGGGAGATCCTGAGCTTTGGGAAGCAGCCCTTCTTCTGGCTGGAGAA
CAAGGATGTCATCGGGGTGCTGGAGAAAGGAGACCGGCTGCCCAAGCCTGATCTCTGTCC
ACCGGTCCTTTATACCCTCATGACCCGCTGCTGGGACTACGACCCCAGTGACCGGCCCCG
CTTCACCGAGCTGGTGTGCAGCCTCAGTGACGTTTATCAGATGGAGAAGGACATTGCCAT
GGAGCAAGAGAGGAATGCTCGCTACCGAACCCCCAAAATCTTGGAGCCCACAGCCTTCCA
GGAACCCCCACCCAAGCCCAGCCGACCTAAGTACAGACCCCCTCCGCAAACCAACCTCCT
GGCTCCAAAGCTGCAGTTCCAGGTTCCTGAGGGTCTGTGTGCCAGCTCTCCTACGCTCAC
CAGCCCTATGGAGTATCCATCTCCCGTTAACTCACTGCACACCCCACCTCTCCACCGGCA
CAATGTCTTCAAACGCCACAGCATGCGGGAGGAGGACTTCATCCAACCCAGCAGCCGAGA
AGAGGCCCAGCAGCTGTGGGAGGCTGAAAAGGTCAAAATGCGGCAAATCCTGGACAAACA
GCAGAAGCAGATGGTGGAGGACTACCAGTGGCTCAGGCAGGAGGAGAAGTCCCTGGACCC
CATGGTTTATATGAATGATAAGTCCCCATTGACGCCAGAGAAGGAGGTCGGCTACCTGGA
GTTCACAGGGCCCCCACAGAAGCCCCCGAGGCTGGGCGCACAGTCCATCCAGCCCACAGC
TAACCTGGACCGGACTGATGACCTGGTGTACCTCAATGTCATGGAGCTGGTGCGGGCCGT
GCTGGAGCTCAAGAATGAGCTCTGTCAGCTGCCCCCCGAGGGCTACGTGGTGGTGGTGAA
GAATGTGGGGCTGACCCTGCGGAAGCTCATCGGGAGCGTGGATGATCTCCTGCCTTCCTT
GCCGTCATCTTCACGGACAGAGATCGAGGGCACCCAGAAACTGCTCAACAAAGACCTGGC
AGAGCTCATCAACAAGATGCGGCTGGCACAGCAGAACGCCGTGACCTCCCTAAGTGAGGA
GTGCAAGAGGCAGATGCTGACGGCTTCACACACCCTGGCTGTGGACGCCAAGAACCTGCT
CGACGCTGTGGACCAGGCCAAGGTTCTGGCCAATCTGGCCCACCCACCTGCAGAGTGACG
GAGGGTGGGGGCCACCTGCCTGCGTCTTCCGCCCCTGCCTGCCATGTACCTCCCCTGCCT
TGCTGTTGGTCATGTGGGTCTTCCAGGGGGAAGGCCAAGGGGAGTCACCTTCCCTTGCCA
CTTTGCACGACGCCCTCTCCCCACCCCTACCCCTGGCTGTACTGCTCAGGCTGCAGCTGG
ACAGAGGGGACTCTGGGCTATGGACACAGGGTGACGGTGACAAAGATGGCTCAGAGGGGG
ACTGCTGCTGCCTGGCCACTGCTCCCTAAGCCAGCCTGGTCCATGCAGGGGGCTCCTGGG
GGTGGGGAGGTGTCACATGGTGCCCCTAGCTTTATATATGGACATGGCAGGCCGATTTGG
GAACCAAGCTATTCCTTTCCCTTCCTCTTCGGCCCTCAGATGTCCCTTGATGCACAGAGA
AGCTGGGGAGGAGCTTTGTTTTGGGGGTCAGGCAGCCAGTGAGATGAGGGATGGGCCTGG
CATTCTTGTACAGTGTATATTGAAATTTATTTAATGTGAGTTTGGTCTGGACTGACAGCA
TGTGCCCTCCTGAGGGAGGACCTGGGGCACAGTCCAGGAACAAGCTAATTGGGAGTCCAG
GCACAGGATGCTGTGTTGTCAACAAACCAAGCATCAGGGGGAAGAAGCAGAGAGATGCGG
CCAAGATAGGACCTTGGGCCAAATCCGCTCTCTTCCTGCCCCTCTTTCTCTTTCTTCCTT
TACTTTCCCTTGCTTTTCCCTCTTTTCTTACTCCTCCTCTTTCTCTCCCCAACCCCCATT
CTCATCTGCACCCTTCTTTTCTCATGTGTTTGCATAAACATTCTTTTAACTTCTTTCTAT
TTGACTTGTGGTTGAATTAAAATTGTCCCATTTGCTTTGCAAAAAAAAAAAAAAAAAAAA
AAAAAAAA

Protein Sequence

>2185 : length: 1009
MSGVSEPLSRVKLGTLRRPEGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVK
CTVQTEIREIITSILLSGRIGPNIRLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYEC
LHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGC
LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYAS
LREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLA
EFKQIRSIRCLPLEEGQAVLQLGIEGAPQALSIKTSSLAEAENMADLIDGYCRLQGEHQG
SLIIHPRKDGEKRNSLPQIPMLNLEARRSHLSESCSIESDIYAEIPDETLRRPGGPQYGI
AREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKN
LDHPHIVKLIGIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYL
ESINCVHRDIAVRNILVASPECVKLGDFGLSRYIEDEDYYKASVTRLPIKWMSPESINFR
RFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLYTLMTR
CWDYDPSDRPRFTELVCSLSDVYQMEKDIAMEQERNARYRTPKILEPTAFQEPPPKPSRP
KYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMR
EEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSP
LTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLELKNELCQ
LPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLA
QQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE