ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

216

Name

ALDH1A1

Synonym

ALDC|ALDH-E1|ALDH1|ALDH11|HEL-9|HEL-S-53e|HEL12|PUMB1|RALDH1;aldehyde dehydrogenase 1 family, member A1;ALDH1A1;aldehyde dehydrogenase 1 family, member A1

Definition

ALDH class 1|ALHDII|RALDH 1|acetaldehyde dehydrogenase 1|aldehyde dehydrogenase 1, soluble|aldehyde dehydrogenase, liver cytosolic|epididymis luminal protein 12|epididymis luminal protein 9|epididymis secretory sperm binding protein Li 53e|retinal dehydro

Position

9q21.13

Gene Type

protein-coding

Pathways and Diseases

Pathway

Biological oxidations;Reactome;REACT:13433

Pathway

Metabolic pathways;KEGG PATHWAY;hsa01100

Pathway

Retinol metabolism;KEGG PATHWAY;hsa00830

Pathway

5-Hydroxytryptamine degredation;PANTHER;P04372

Disease

Drug abuse;FunDO

Disease

CHEMDEPENDENCY;GAD

Disease

Dermatitis;FunDO

Disease

Rheumatoid arthritis;FunDO

Disease

alcohol abuse;GAD

Disease

Uterine fibroids;FunDO

Disease

smoking behavior;GAD

Disease

Liver cancer;FunDO

External Links

Links to cell senescence gene database

216

Links to epithelial mesenchymal transition gene database

216

Links to ovarian cancer gene database

216

Links to endometrial cancer gene database

216

Links to iHOP

216

Sequence Information

Nucleotide Sequence

>216 : length: 2378
GCTGCATACACTTATCACAGGTTTCGGCTTTGTAAATTAATTCATCTGCAAATAGTGCAC
TGTCTCCAGGTACAAATTCGATGCTGGAGCACTGGTTTCTTAAGGATTTAAGTTTAAAGT
CAAAGGCTTCCTGCCCTAGGTGTTACAAATAAGTAGTGTCGTTTTCTTTTTTTGCTCTGA
GTTTGTTCATCCAATCGTATCCGAGTATGCAAATAAACTTTAGCCCGTGCAGATAAAAAA
GGAACAAATAAAGCCAAGTGCTCTATCAGAACCAAATTGCTGAGCCAGTCACCTGTGTTC
CAGGAGCCGAATCAGAAATGTCATCCTCAGGCACGCCAGACTTACCTGTCCTACTCACCG
ATTTGAAGATTCAATATACTAAGATCTTCATAAACAATGAATGGCATGATTCAGTGAGTG
GCAAGAAATTTCCTGTCTTTAATCCTGCAACTGAGGAGGAGCTCTGCCAGGTAGAAGAAG
GAGATAAGGAGGATGTTGACAAGGCAGTGAAGGCCGCAAGACAGGCTTTTCAGATTGGAT
CCCCGTGGCGTACTATGGATGCTTCCGAGAGGGGGCGACTATTATACAAGTTGGCTGATT
TAATCGAAAGAGATCGTCTGCTGCTGGCGACAATGGAGTCAATGAATGGTGGAAAACTCT
ATTCCAATGCATATCTGAATGATTTAGCAGGCTGCATCAAAACATTGCGCTACTGTGCAG
GTTGGGCTGACAAGATCCAGGGCCGTACAATACCAATTGATGGAAATTTTTTTACATATA
CAAGACATGAACCTATTGGTGTATGTGGCCAAATCATTCCTTGGAATTTCCCGTTGGTTA
TGCTCATTTGGAAGATAGGGCCTGCACTGAGCTGTGGAAACACAGTGGTTGTCAAACCAG
CAGAGCAAACTCCTCTCACTGCTCTCCACGTGGCATCTTTAATAAAAGAGGCAGGGTTTC
CTCCTGGAGTAGTGAATATTGTTCCTGGTTATGGGCCTACAGCAGGGGCAGCCATTTCTT
CTCACATGGATATAGACAAAGTAGCCTTCACAGGATCAACAGAGGTTGGCAAGTTGATCA
AAGAAGCTGCCGGGAAAAGCAATCTGAAGAGGGTGACCCTGGAGCTTGGAGGAAAGAGCC
CTTGCATTGTGTTAGCTGATGCCGACTTGGACAATGCTGTTGAATTTGCACACCATGGGG
TATTCTACCACCAGGGCCAGTGTTGTATAGCCGCATCCAGGATTTTTGTGGAAGAATCAA
TTTATGATGAGTTTGTTCGAAGGAGTGTTGAGCGGGCTAAGAAGTATATCCTTGGAAATC
CTCTGACCCCAGGAGTCACTCAAGGCCCTCAGATTGACAAGGAACAATATGATAAAATAC
TTGACCTCATTGAGAGTGGGAAGAAAGAAGGGGCCAAACTGGAATGTGGAGGAGGCCCGT
GGGGGAATAAAGGCTACTTTGTCCAGCCCACAGTGTTCTCTAATGTTACAGATGAGATGC
GCATTGCCAAAGAGGAGATTTTTGGACCAGTGCAGCAAATCATGAAGTTTAAATCTTTAG
ATGACGTGATCAAAAGAGCAAACAATACTTTCTATGGCTTATCAGCAGGAGTGTTTACCA
AAGACATTGATAAAGCCATAACAATCTCCTCTGCTCTGCAGGCAGGAACAGTGTGGGTGA
ATTGCTATGGCGTGGTAAGTGCCCAGTGCCCCTTTGGTGGATTCAAGATGTCTGGAAATG
GAAGAGAACTGGGAGAGTACGGTTTCCATGAATATACAGAGGTCAAAACAGTCACAGTGA
AAATCTCTCAGAAGAACTCATAAAGAAAATACAAGAGTGGAGAGAAGCTCTTCAATAGCT
AAGCATCTCCTTACAGTCACTAATATAGTAGATTTTAAAGACAAAATTTTTCTTTTCTTG
ATTTTTTTAAACATAAGCTAAATCATATTAGTATTAATACTACCCATAGAAAACTTGACA
TGTAGCTTCTTCTGAAAGAATTATTTGCCTTCTGAAATGTGACCCCCAAGTCCTATCCTA
AATAAAAAAAGACAAATTCGGATGTATGATCTCTCTAGCTTTGTCATAGTTATGTGATTT
TCCTTTGTAGCTACTTTTGCAGGATAATAATTTTATAGAAAAGGAACAGTTGCATTTAGC
TTCTTTCCCTTAGTGACTCTTGAAGTACTTAACATACACGTTAACTGCAGAGTAAATTGC
TCTGTTCCCAGTAGTTATAAAGTCCTTGGACTGTTTTGAAAAGTTTCCTAGGATGTCATG
TCTGCTTGTCAAAAGAAATAATCCCTGTAATATTTAGCTGTAAACTGAATATAAAGCTTA
ATAAAAACAACCTTGCATGATTCTTGTTAAAAAAAAAA

Protein Sequence

>216 : length: 501
MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDV
DKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYL
NDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKI
GPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDID
KVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQG
QCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIES
GKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKR
ANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGE
YGFHEYTEVKTVTVKISQKNS