ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2130

Name

EWSR1

Synonym

EWS|bK984G1.4;EWS RNA-binding protein 1;EWSR1;EWS RNA-binding protein 1

Definition

EWS RNA-binding protein variant 6|Ewing sarcoma breakpoint region 1|Ewings sarcoma EWS-Fli1 (type 1) oncogene|RNA-binding protein EWS

Position

22q12.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

BARD1 signaling events;PID Curated;200174

Disease

Extraskeletal myxoid chondrosarcoma;KEGG DISEASE;H00053

Disease

Cancers;KEGG DISEASE

Disease

Clear cell sarcoma of soft tissue;KEGG DISEASE;H00052

Disease

Cancers of soft tissues and bone;KEGG DISEASE

Disease

Ewing sarcoma;OMIM

Disease

Myxoid liposarcoma;KEGG DISEASE;H00049

Disease

Cancer;FunDO

Disease

Neuroepithelioma;OMIM

Disease

Ewing's sarcoma;KEGG DISEASE;H00035

External Links

Links to cell senescence gene database

2130

Links to epithelial mesenchymal transition gene database

2130

Links to ovarian cancer gene database

2130

Links to endometrial cancer gene database

2130

Links to iHOP

2130

Sequence Information

Nucleotide Sequence

>2130 : length: 2694
AGAGCCAGCGGACGGAACCATTCCAAACAGCCTAGTCTCGTGCTGAGAGCCTCTCCGGTT
TCACGCTGAGACCCGCTCACCCCCGCTCTGGCCCCTTAGATGCTATTTTGGCCCGAGTGT
CACGTCGGGCGCTCTTTAGAGAGGACTGGGACAAGAGTTGCGGACGCGAAGAACGAGTAA
GCGGTGGTTCATCCCTCCTGACCCCACCCCCGTGGCCTGGCCCGATGGTCGCGCCCGGGG
TTGCGAGATTTGCGCCTGCGCAGTGCGGCGCCTAGAGGGAAAGCGAGAGGGAGACGGACG
TTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCA
AGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACA
GACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAG
CTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGG
ACAGCCTCCCACTGTAGAAGGGACCAGTACAGGTTATACTACTCCAACTGCCCCCCAGGC
ATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGT
CACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCC
AGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCC
CACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATA
TGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCAC
TGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCA
GAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAG
CTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGG
ATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAG
TTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATT
TTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGG
GGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATGGG
CGCTGGAGAGCGAGGTGGCTTCAATAAGCCTGGTGGACCCATGGATGAAGGACCAGATCT
TGATCTAGGCCCACCTGTAGATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTACA
AGGATTAAATGACAGTGTGACTCTAGATGATCTGGCAGACTTCTTTAAGCAGTGTGGGGT
TGTTAAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAAC
AGGAAAGCCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGC
CGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACTTAAAGTCTCCCTTGCTCG
GAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCAT
GCCACCACCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCG
CATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAGAGGACCCCGGGGTTCCCG
AGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAA
TCCGGGTTGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCC
AAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGGTGGTGATCGTGGCAGAGG
TGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGG
AATGTTCAGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGA
CCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCCCCTGGACCTTTGAT
GGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGA
GCACCGTCAGGAGCGCAGAGATCGGCCCTACTAGATGCAGAGACCCCGCAGAGCTGCATT
GACTACCAGATTTATTTTTTAAACCAGAAAATGTTTTAAATTTATAATTCCATATTTATA
ATGTTGGCCACAACATTATGATTATTCCTTGTCTGTACTTTAGTATTTTTCACCATTTGT
GAAGAAACATTAAAACAAGTTAAATGGTAGTGTGCGGAGTTTTTTTTTCTTCCTTCTTTT
AAAAATGGTTGTTTAAGACTTTAACAATGGGAACCCCTTGTGAGCATGCTCAGTATCATT
GTGGAGAACCAAGAGGGCCTCTTAACTGTAACAATGTTCATGGTTGTGATGTTTTTTTTT
TTTTTTTAAATAAAATTCCAAATGTTTATAAAGAGTCAAAAAAAAAAAAAAAAA

Protein Sequence

>2130 : length: 670
MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQQAYGQQSYGTYGQPTDVSYTQAQTTA
TYGQTAYATSYGQPPTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYG
TQPAYPAYGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSY
PMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQQSSYGQQSSYGQQPPTS
YPPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQESGGFSGPGENRSMSGPDN
RGRGRGGFDRGGMSRGGRGGGRGGMGSAGERGGFNKPGGPMDEGPDLDLGPPVDPDEDSD
NSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYED
PPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGG
PGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPSIGDFCCDVIVC
RGCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGG
MFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPPGPLMEQMGGRRGGRGGPGKMDKGE
HRQERRDRPY