ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2123

Name

EVI2A

Synonym

EVDA|EVI-2A|EVI2;ecotropic viral integration site 2A;EVI2A;ecotropic viral integration site 2A

Definition

ecotropic viral integration site 2A protein homolog|protein EVI2A

Position

17q11.2

Gene Type

protein-coding

External Links

Links to cell senescence gene database

2123

Links to epithelial mesenchymal transition gene database

2123

Links to ovarian cancer gene database

2123

Links to endometrial cancer gene database

2123

Links to iHOP

2123

Sequence Information

Nucleotide Sequence

>2123 : length: 3010
AGAGAAGTTGGAGCTTTTTCGTTGTTTTTTTTTTTTTCCCTCCTGTGACATGTGCTTTAG
TTGCAGTGGAAAGGAAATGTGTCATCTGTGGTTTGGTTTTAAAAGTGGAAAACTAGCTGC
ACATATCCTTTTTTACTGCAGATTTACTTTAAGGCTCATATTCTCCAAGTCTATTCTGCT
TTAAAAAGAAGACAAGAAAAGAAGTGGTTTATCAAAATCACGTTATAATCAGATTTTGAC
CAAGCATTTTGTAAGTATACAAATGTCAGCCAATGACATATAACAACCATTTCTTATAAA
ACCTTGATGTTCAAAAGCCTGACTAGCAGTGGCATCCATGTTGCTTAGGAGTTGGTTTGG
AAACAAAGACTTTCAGGCCCTACCTATACTAGCTAGATTGCCAAGCATGCCCACGGACAT
GGAACACACAGGACATTACCTACATCTTGCCTTTCTGATGACAACAGTTTTTTCTTTGTC
TCCTGGAACAAAAGCAAACTATACCCGTCTGTGGGCTAACAGTACTTCTTCCTGGGATTC
AGTTATTCAAAACAAGACAGGCAGAAACCAAAATGAAAACATTAACACAAACCCTATAAC
TCCTGAAGTAGATTATAAAGGTAATTCTACAAACATGCCTGAAACATCTCACATCGTAGC
TTTAACTTCTAAATCTGAACAGGAGCTTTATATACCTTCTGTCGTCAGCAACAGTCCTTC
AACAGTACAGAGCATTGAAAACACAAGCAAAAGTCATGGTGAAATTTTCAAAAAGGATGT
CTGTGCGGAAAACAACAACAACATGGCTATGCTAATTTGCTTAATTATAATTGCAGTGCT
TTTTCTTATCTGTACCTTTCTATTTCTATCAACTGTGGTTTTGGCAAACAAAGTCTCTTC
TCTCAGACGATCAAAACAAGTAGGCAAGCGTCAGCCTAGAAGCAATGGCGATTTTCTGGC
AAGCGGTCTATGGCCCGCTGAATCAGACACTTGGAAAAGAACAAAACAGCTCACAGGACC
CAACCTAGTGATGCAATCTACTGGAGTGCTCACAGCTACAAGGGAAAGAAAAGATGAAGA
AGGAACTGAAAAACTTACTAACAAACAGATAGGTTAGTGAAGAAAAATGCAAAGTAGCAA
TGAGAAGGCTTATGGAGTAAAAATGAAGTCAGTTGGTATTTAATCCCAAAGTGTTGTTCT
GATTATCTAAAATTTGACATGGTAGACCTTGCAATTTAGAATCAAGCAGGTGAGACAGGG
AGAAGTATGCCTGCTTAATTATTTAAACTGTGTACTTTTGTTTTGACACTGAATATTTTA
AAAAGCAAATAATAAAATAACTAAGCATTTGAGGAAAATTTTAAGGATAAATTGAGGAAA
CTGATTAATAGAGATAGCAAGGGATAATTAAATAAATATTCCCTATGTAGCAACAGTGGT
TAGATGATCTTTGTCTGAATGTAATTAAACTTTGAATAGTTTTAGTGTGTCCTTAAAGCC
AAGTATATGCTTTAACATCAAATGGAAGTCAAATTCCTAATGCATAGATAGAGAGAGCTA
AACTGTGTAATTTAATGGTATCTTCCTTGCTGGATGTGGCAGAATCCACACCAGCTTATC
AACCAACACAGCTAATTTTAGAATAGATCCTTTATCTTTCCATATGGCACACGTAAGAAA
GTGTTTTTCTACTATTAATATTAAATTAAAACCTTTACTTTTGTATAATAAATTAAAACT
CAGAATAAACCTGTGACCACGTATATTTGCATTCACTTTATTACTTTAGAGAACACATTG
TAAAGATCAATAAGAAATAGAGCACAACTAAAATAAATAAGATTTATAGCCACACCAATA
GGCTAAGTGTAAACGCAAAGTATGTTTCACTGTTTATGATTAATAATATTCATCTTTTCT
ATAAATACTACTTACTGGAACATTAACAACAAGTACCAAAGGTTGATTAATTTTTGGACT
TCAAGGATGCCAAGTAGCCTAATGATTTATTAGGGGTGTGTGTGTGTGTGTGTGTGTGTG
TGTGTGTGTGTTCAAATCTGGAAAACTGCATACTTCAGGTTATAATTTAACCTTTAAAGA
AACTGGCTTCAAGTAAAATAATGACTTACATTTAAGTTGAGAACCCCCCCATCTTCAATT
AAATATATTACAAAAATTGGTTTGAGAGACTTTCCAAATATCTACTGAAATTAACACAGG
GCTAAGATCAGGCCACATTTCAAAAATCTCATCCCTTACTGGGCATTTATTTCGGGCAAT
ATAGTAACCATTTTAAAAATATTTTTTATATGTTTTTTCCCAAGTATGACTACAATCTTA
CTCTCCCTTCTAAGCTAGTGATTCTTACCCTGGCTGCATGTCAGAATCACCTGAAGAGTT
TTTAAAAAACACCAATGCCTAATTCCCATGTCTTCCTTCTGATGCAACTGGAATGGGGTG
AACTCTAAGCATTGGTAATTTTTACGTAACTCTCAAGGTGATAACTGCTCTTGGTCATCA
AATTCAAACGTCTAGCTATTATTAAAATGAGAGGAAAAAAATAAAGCATCATTTTTATTA
TCAATTTATTAGCAATTTGTAAAAAACAAATCTATTCTCTAAACGAGAAATCATAACAAT
ATTATTCCAGATAAAGTTAAGTGTTAACAAAGTAAAAAGGAAAGCATGAGAATATTCATG
CCAGTCATGGTGACTGAAATCAGGTTATCTTTTGAGGGGAAAAATAACCCAGATTAGAAA
TGAAACTGGGCAGACTTCCCATTCTGTGCAAAAATTGAAAATTTGAGATTGTGCACCAGT
ACATCCAGGAGTAACACAAAGCACTCCTTGAATCAAGGGTCATAAATAAACACGTGTCAG
AGAAAATTAAAAGAAATTAATATCATCATAAAAATAGGAAATTACTTTCATATTCAACAT
ACTGGTCAAACATTTTCTCACCAGAGAGCTTCTACCACAAGGATATTTAAAAGAATATTT
AAAATTCACC

Protein Sequence

>2123 : length: 259
MLLRSWFGNKDFQALPILARLPSMPTDMEHTGHYLHLAFLMTTVFSLSPGTKANYTRLWA
NSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNSTNMPETSHIVALTSKSEQELYIP
SVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNMAMLICLIIIAVLFLICTFLFLSTV
VLANKVSSLRRSKQVGKRQPRSNGDFLASGLWPAESDTWKRTKQLTGPNLVMQSTGVLTA
TRERKDEEGTEKLTNKQIG