ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2122

Name

MECOM

Synonym

AML1-EVI-1|EVI1|MDS1|MDS1-EVI1|PRDM3;MDS1 and EVI1 complex locus;MECOM;MDS1 and EVI1 complex locus

Definition

AML1-EVI-1 fusion protein|MDS1 and EVI1 complex locus protein EVI1|MDS1 and EVI1 complex locus protein MDS1|ecotropic virus integration site 1 protein homolog|myelodysplasia syndrome-associated protein 1|oncogene EVI1|zinc finger protein Evi1

Position

3q26.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Disease

Serum magnesium levels;NHGRI

Disease

Systolic blood pressure;NHGRI

Disease

Cancers;KEGG DISEASE

Disease

Fanconi's anemia;FunDO

Disease

3q21q26 syndrome;OMIM

Disease

Cancers of haematopoietic and lymphoid tissues;KEGG DISEASE

Disease

Leukemia;FunDO

Disease

Chronic myeloid leukemia (CML);KEGG DISEASE;H00004

Disease

Myelodysplasia syndrome-1;OMIM

Disease

Diastolic blood pressure;NHGRI

Disease

Nasopharyngeal carcinoma;NHGRI

External Links

Links to cell senescence gene database

2122

Links to epithelial mesenchymal transition gene database

2122

Links to ovarian cancer gene database

2122

Links to endometrial cancer gene database

2122

Links to iHOP

2122

Sequence Information

Nucleotide Sequence

>2122 : length: 5943
TTTTCCTTGCGCTCTTCTCCTCCTTCCCCTCCCTCCGTGTGTCTCTGTCCGTCGGTTTCG
GGGACGCACAAGGTGCGGTTGCCAAAATCTGAATTCCTGGCACTGGCCACGCGACTTTGG
AGCCGCTCTCGGCCGAGTTCCACCTTGCCAAGTAACAGCTTTGCTGTCCAACATCGTGTG
CTGCTTCGCGAGAAAGTCACATTCGGACCCTTTGGCTAGATTGTGGGGATTTTTTTTTTT
TTCCTTTTGCTGTTGGTTTTTTGAAAGGGCCTTTCTCTAAAGTCTACCTAAACGGTTTTT
TTTTAAGCTATCTTTGGAGGTTGACAGCTTTTAAAAACACAGGAGTGTGTTATATGAAAT
GACTGAAGATGTGTCGTTACTTTATTTTATTCGAGATTTCCGACACGATTAAGACATTTG
GGAGACAAATGCAGTTCTGCTAGCAAATCAAAAGTGAATAATTCACCCAGGGGGCAAACG
TTTCTGGAGAAAGCTAAGCTTTTGTCTTGGGGCAAGAATATTGAGAGGAAGAATGTTAAT
ATGATGGTGAAATCTTTGAATAATCGTATAACAGATTAGTAAAAAGACATTCTTTGGAAA
TGAACCTTTTTAAAAATTAATTTTGCTGTTGACAGTGGCAATGCTAATAATGTTAACACG
GAATAAAATTACACCTACAATTTTTATGTGCAGTGTATGTAATACTTAACTCCCTGCCCC
TGTGAAAGGGTATGCTTGAAAGCTAAGGGGATGGATGCTTCTTGACTTTGAAATTAACAA
GTTTTCCACGTCTCTCTGCAAATATGAAATGGAATTAGTATTGCATTTCACTGGCTTTAT
TCTATGTCCTTTATTAAATATTTCTTTGGTGTGTCAGGAGAACTGCCTTTTCTTTTTCTT
TTTTTCTTTTTTTTCTTTTTTTTGCCAGTCAAGGAAACAAACAACAAAAGATCAACCAGA
AACCAAACAGACTGAACAAACCAACAAAACCCAGCAACAAACTCCAACTTTTTACTATTT
AAAAATGTGCATTGCTATTATTTATGTACCTTCTCAACATCTGGGATGGGGGGAAATCTC
AAGTTGCCATTTGAGTTACTCAGCACTGAGAGTTGAAGAAACATCTTAAAGCTTATTCAT
AGGGCTTCTTGACTAAAGCCCTTGGAGCACTGGGTTTTTCTTGAAGTATATGATCTTAGA
CGAATTTTACAATGTGAAGTTCTGCATAGATGCCAGTCAACCAGATGTTGGAAGCTGGCT
CAAGTACATTAGATTCGCTGGCTGTTATGATCAGCACAACCTTGTTGCATGCCAGATAAA
TGATCAGATATTCTATAGAGTAGTTGCAGACATTGCGCCGGGAGAGGAGCTTCTGCTGTT
CATGAAGAGCGAAGACTATCCCCATGAAACTATGGCGCCGGATATCCACGAAGAACGGCA
ATATCGCTGCGAAGACTGTGACCAGCTCTTTGAATCTAAGGCTGAACTAGCAGATCACCA
AAAGTTTCCATGCAGTACTCCTCACTCAGCATTTTCAATGGTTGAAGAGGACTTTCAGCA
AAAACTCGAAAGCGAGAATGATCTCCAAGAGATACACACGATCCAGGAGTGTAAGGAATG
TGACCAAGTTTTTCCTGATTTGCAAAGCCTGGAGAAACACATGCTGTCACATACTGAAGA
GAGGGAATACAAGTGTGATCAGTGTCCCAAGGCATTTAACTGGAAGTCCAATTTAATTCG
CCACCAGATGTCACATGACAGTGGAAAGCACTATGAATGTGAAAACTGTGCCAAGCAGGT
TTTCACGGACCCTAGCAACCTTCAGCGGCACATTCGCTCTCAGCATGTCGGTGCCCGGGC
CCATGCATGCCCGGAGTGTGGCAAAACGTTTGCCACTTCGTCGGGCCTCAAACAACACAA
GCACATCCACAGCAGTGTGAAGCCCTTTATCTGTGAGGTCTGCCATAAATCCTATACTCA
GTTTTCAAACCTTTGCCGTCATAAGCGCATGCATGCTGATTGCAGAACCCAAATCAAGTG
CAAAGACTGTGGACAAATGTTCAGCACTACGTCTTCCTTAAATAAACACAGGAGGTTTTG
TGAGGGCAAGAACCATTTTGCGGCAGGTGGATTTTTTGGCCAAGGCATTTCACTTCCTGG
AACCCCAGCTATGGATAAAACGTCCATGGTTAATATGAGTCATGCCAACCCGGGCCTTGC
TGACTATTTTGGCGCCAATAGGCATCCTGCTGGTCTTACCTTTCCAACAGCTCCTGGATT
TTCTTTTAGCTTCCCTGGTCTGTTTCCTTCCGGCTTGTACCACAGGCCTCCTTTGATACC
TGCTAGTTCTCCTGTTAAAGGACTATCAAGTACTGAACAGACAAACAAAAGTCAAAGTCC
CCTCATGACACATCCTCAGATACTGCCAGCTACACAGGATATTTTGAAGGCACTATCTAA
ACACCCATCTGTAGGGGACAATAAGCCAGTGGAGCTCCAGCCCGAGAGGTCCTCTGAAGA
GAGGCCCTTTGAGAAAATCAGTGACCAGTCAGAGAGTAGTGACCTTGATGATGTCAGTAC
ACCAAGTGGCAGTGACCTGGAAACAACCTCGGGCTCTGATCTGGAAAGTGACATTGAAAG
TGATAAAGAGAAATTTAAAGAAAATGGTAAAATGTTCAAAGACAAAGTAAGCCCTCTTCA
GAATCTGGCTTCAATAAATAATAAGAAAGAATACAGCAATCATTCCATTTTCTCACCATC
TTTAGAGGAGCAGACTGCGGTGTCAGGAGCTGTGAATGATTCTATAAAGGCTATTGCTTC
TATTGCTGAAAAATACTTTGGTTCAACAGGACTGGTGGGGCTGCAAGACAAAAAAGTTGG
AGCTTTACCTTACCCTTCCATGTTTCCCCTCCCATTTTTTCCAGCATTCTCTCAATCAAT
GTACCCATTTCCTGATAGAGACTTGAGATCGTTACCTTTGAAAATGGAACCCCAATCACC
AGGTGAAGTAAAGAAACTGCAGAAGGGCAGCTCTGAGTCCCCCTTTGATCTCACCACTAA
GCGAAAGGATGAGAAGCCCTTGACTCCAGTCCCCTCCAAGCCTCCAGTGACACCTGCCAC
AAGCCAAGACCAGCCCCTGGATCTAAGTATGGGCAGTAGGAGTAGAGCCAGTGGGACAAA
GCTGACTGAGCCTCGAAAAAACCACGTGTTTGGGGGAAAAAAAGGAAGCAACGTCGAATC
AAGACCTGCTTCAGATGGTTCCTTGCAGCATGCAAGACCCACTCCTTTCTTTATGGACCC
TATTTACAGAGTAGAGAAAAGAAAACTAACTGACCCACTTGAAGCTTTAAAAGAGAAATA
CTTGAGGCCTTCTCCAGGATTCTTGTTTCACCCACAATTCCAACTGCCTGATCAGAGAAC
TTGGATGTCAGCTATTGAAAACATGGCAGAAAAGCTAGAGAGCTTCAGTGCCCTGAAACC
TGAGGCCAGTGAGCTCTTACAGTCAGTGCCCTCTATGTTCAACTTCAGGGCGCCTCCCAA
TGCCCTGCCAGAGAACCTTCTGCGGAAGGGAAAGGAGCGCTATACCTGCAGATACTGTGG
CAAGATTTTTCCAAGGTCTGCAAACCTAACACGGCACTTGAGAACCCACACAGGAGAGCA
GCCTTACAGATGCAAATACTGTGACAGATCATTTAGCATATCTTCTAACTTGCAAAGGCA
TGTTCGCAACATCCACAATAAAGAGAAGCCATTTAAGTGTCACTTATGTGATAGGTGTTT
TGGTCAACAAACCAATTTAGACAGACACCTAAAGAAACATGAGAATGGGAACATGTCCGG
TACAGCAACATCGTCGCCTCATTCTGAACTGGAAAGTACAGGTGCGATTCTGGATGACAA
AGAAGATGCTTACTTCACAGAAATTCGAAATTTCATTGGGAACAGCAACCATGGCAGCCA
ATCTCCCAGGAATGTGGAGGAGAGAATGAATGGCAGTCATTTTAAAGATGAAAAGGCTTT
GGTGACCAGTCAAAATTCAGACTTGCTGGATGATGAAGAAGTTGAAGATGAGGTGTTGTT
AGATGAGGAGGATGAAGACAATGATATTACTGGAAAAACAGGAAAGGAACCAGTGACAAG
TAATTTACATGAAGGAAACCCTGAGGATGACTATGAAGAAACCAGTGCCCTGGAGATGAG
TTGCAAGACATCCCCAGTGAGGTATAAAGAGGAAGAATATAAAAGTGGACTTTCTGCTCT
AGATCATATAAGGCACTTCACAGATAGCCTCAAAATGAGGAAAATGGAAGATAATCAATA
TTCTGAAGCTGAGCTGTCTTCTTTTAGTACTTCCCATGTGCCAGAGGAACTTAAGCAGCC
GTTACACAGAAAGTCCAAATCGCAGGCATATGCTATGATGCTGTCACTGTCTGACAAGGA
GTCCCTCCATTCTACATCCCACAGTTCTTCCAACGTGTGGCACAGTATGGCCAGGGCTGC
GGCGGAATCCAGTGCTATCCAGTCCATAAGCCACGTATGACGTTATCAAGGTTGACCAGA
GTGGGACCAAGTCCAACAGTAGCATGGCTCTTTCATATAGGACTATTTACAAGACTGCTG
AGCAGAATGCCTTATAAACCTGCAGGGTCACTCATCTAAAGTCTAGTGACCTTAAACTGA
ATGATTTAAAAAAGAAAAGAAAGAAAAAAGAAACTATTTATTCTCGATATTTTGTTTTGC
ACAGCAAAGGCAGCTGCTGACTTCTGGAAGATCAATCAATGCGACTTAAAGTGATTCAGT
GAAAACAAAAAACTTGGTGGGCTGAAGGCATCTTCCAGTTTACCCCACCTTAGGGTATGG
GTGGGTGAGAAGGGCAGTTGAGATGGCAGCATTGATATGAATGAACACTCCATAGAAACT
GAATTCTCTTTTGTACAAGATCACCTGACATGATTGGGAACAGTTGCTTTTAATTACAGA
TTTAATTTTTTTCTTCGTTAAAGTTTTATGTAATTTAACCCTTTGAAGACAGAAGTAGTT
GGATGAAATGCACAGTCAATTATTATAGAAACTGATAACAGGGAGTACTTGTTCCCCCTT
TTGCCTTCTTAAGTACATTGTTTAAAACTAGGGAAAAAGGGTATGTGTATATTGTAAACT
ATGGATGTTAACACTCAAAGAGGTTAAGTCAGTGAAGTAACCTATTCATCACCAGTACCG
CTGTACCACTAATAAATTGTTTGCCAAATCCTTGTAATAACATCTTAATTTTAGACAATC
ATGTCACTGTTTTTAATGTTTATTTTTTTGTGTGTGTTGCGTGTATCATGTATTTATTTG
TTGGCAAACTATTGTTTGTTGATTAAAATAGCACTGTTCCAGTCAGCCACTACTTTATGA
CGTCTGAGGCACACCCCTTTCCGAATTTCAAGGACCAAGGTGACCCGACCTGTGTATGAG
AGTGCCAAATGGTGTTTGGCTTTTCTTAACATTCCTTTTTGTTTGTTTGTTTTGTTTTCC
TTCTTAATGAACTAAATACGAATAGATGCAACTTAGTTTTTGTAATACTGAAATCGATTC
AATTGTATAAACGATTATAATTTCTTTCATGGAAGCATGATTCTTCTGATTAAAAACTGT
ACTCCATATTTTATGCTGGTTGTCTGCAAGCTTGTGCGATGTTATGTTCATGTTAATCCT
ATTTGTAAAATGAAGTGTTCCCAACCTTATGTTAAAAGAGAGAAGTAAATAACAGACTGT
ATTCAGTTATTTTGCCCTTTATTGAGGAACCAGATTTGTTTTCTTTTTGTTTGTAATCTC
ATTTTGAAATAATCAGCAAGTTGAGGTACTTTCTTCAAATGCTTTGTACAATATAAACTG
TTATGCCTTTCAGTGCATTACTATGGGAGGAGCAACTAAAAAATAAAGACTTACAAAAAG
GAG

Protein Sequence

>2122 : length: 1240
MRSKGRARKLATNNECVYGNYPEIPLEEMPDADGVASTPSLNIQEPCSPATSSEAFTPKE
GSPYKAPIYIPDDIPIPAEFELRESNMPGAGLGIWTKRKIEVGEKFGPYVGEQRSNLKDP
SYGWEILDEFYNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIA
PGEELLLFMKSEDYPHETMAPDIHEERQYRCEDCDQLFESKAELADHQKFPCSTPHSAFS
MVEEDFQQKLESENDLQEIHTIQECKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAF
NWKSNLIRHQMSHDSGKHYECENCAKQVFTDPSNLQRHIRSQHVGARAHACPECGKTFAT
SSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSS
LNKHRRFCEGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLADYFGANRHPAGL
TFPTAPGFSFSFPGLFPSGLYHRPPLIPASSPVKGLSSTEQTNKSQSPLMTHPQILPATQ
DILKALSKHPSVGDNKPVELQPERSSEERPFEKISDQSESSDLDDVSTPSGSDLETTSGS
DLESDIESDKEKFKENGKMFKDKVSPLQNLASINNKKEYSNHSIFSPSLEEQTAVSGAVN
DSIKAIASIAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLP
LKMEPQSPGEVKKLQKGSSESPFDLTTKRKDEKPLTPVPSKPPVTPATSQDQPLDLSMGS
RSRASGTKLTEPRKNHVFGGKKGSNVESRPASDGSLQHARPTPFFMDPIYRVEKRKLTDP
LEALKEKYLRPSPGFLFHPQFQLPDQRTWMSAIENMAEKLESFSALKPEASELLQSVPSM
FNFRAPPNALPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFS
ISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELES
TGAILDDKEDAYFTEIRNFIGNSNHGSQSPRNVEERMNGSHFKDEKALVTSQNSDLLDDE
EVEDEVLLDEEDEDNDITGKTGKEPVTSNLHEGNPEDDYEETSALEMSCKTSPVRYKEEE
YKSGLSALDHIRHFTDSLKMRKMEDNQYSEAELSSFSTSHVPEELKQPLHRKSKSQAYAM
MLSLSDKESLHSTSHSSSNVWHSMARAAAESSAIQSISHV