ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2118

Name

ETV4

Synonym

E1A-F|E1AF|PEA3|PEAS3;ets variant 4;ETV4;ets variant 4

Definition

ETS translocation variant 4|EWS protein/E1A enhancer binding protein chimera|adenovirus E1A enhancer-binding protein|ets variant gene 4 (E1A enhancer-binding protein, E1AF)|polyomavirus enhancer activator 3 homolog

Position

17q21

Gene Type

protein-coding

Pathways and Diseases

Pathway

LKB1 signaling events;PID Curated;200061

Disease

Cancers of soft tissues and bone;KEGG DISEASE

Disease

Cancers;KEGG DISEASE

Disease

Ewing's sarcoma;KEGG DISEASE;H00035

Disease

Cancer;FunDO

External Links

Links to cell senescence gene database

2118

Links to epithelial mesenchymal transition gene database

2118

Links to ovarian cancer gene database

2118

Links to endometrial cancer gene database

2118

Links to iHOP

2118

Sequence Information

Nucleotide Sequence

>2118 : length: 2469
GAAACAAAGGGAAACGGGGGGCGGTGTGGCGGGGCGGGGGGTGGAGAGCTGAGGCCGAGC
GAAGGAAATGCACCAATCAGCTGCTCCCCCGGGCTCACAACTGTCTGCTGCGCCCGAAAA
ACAAGTCGGTGCGCTGGGGACCCGGGGCCGGGGCCGCCTTACTCCGGCCTAGCCCCGCGG
CCCTCGGTGCGGGCTCCAGGGCATGCTCGGGACCCCCCGCGGCTCCAGCCCAGACGCCCC
GGCCTCAGGTCTCGGCCCCCGCTTGGGGCCCCGGCCGTGCGGCCGGAGGGAGCGGCCGGA
TGGAGCGGAGGATGAAAGCCGGATACTTGGACCAGCAAGTGCCCTACACCTTCAGCAGCA
AATCGCCCGGAAATGGGAGCTTGCGCGAAGCGCTGATCGGCCCGCTGGGGAAGCTCATGG
ACCCGGGCTCCCTGCCGCCCCTCGACTCTGAAGATCTCTTCCAGGATCTAAGTCACTTCC
AGGAGACGTGGCTCGCTGAAGCTCAGGTACCAGACAGTGATGAGCAGTTTGTTCCTGATT
TCCATTCAGAAAACCTAGCTTTCCACAGCCCCACCACCAGGATCAAGAAGGAGCCCCAGA
GTCCCCGCACAGACCCGGCCCTGTCCTGCAGCAGGAAGCCGCCACTCCCCTACCACCATG
GCGAGCAGTGCCTTTACTCCAGTGCCTATGACCCCCCCAGACAAATCGCCATCAAGTCCC
CTGCCCCTGGTGCCCTTGGACAGTCGCCCCTACAGCCCTTTCCCCGGGCAGAGCAACGGA
ATTTCCTGAGATCCTCTGGCACCTCCCAGCCCCACCCTGGCCATGGGTACCTCGGGGAAC
ATAGCTCCGTCTTCCAGCAGCCCCTGGACATTTGCCACTCCTTCACATCTCAGGGAGGGG
GCCGGGAACCCCTCCCAGCCCCCTACCAACACCAGCTGTCGGAGCCCTGCCCACCCTATC
CCCAGCAGAGCTTTAAGCAAGAATACCATGATCCCCTGTATGAACAGGCGGGCCAGCCAG
CCGTGGACCAGGGTGGGGTCAATGGGCACAGGTACCCAGGGGCGGGGGTGGTGATCAAAC
AGGAACAGACGGACTTCGCCTACGACTCAGATGTCACCGGGTGCGCATCAATGTACCTCC
ACACAGAGGGCTTCTCTGGGCCCTCTCCAGGTGACGGGGCCATGGGCTATGGCTATGAGA
AACCTCTGCGACCATTCCCAGATGATGTCTGCGTTGTCCCTGAGAAATTTGAAGGAGACA
TCAAGCAGGAAGGGGTCGGTGCATTTCGAGAGGGGCCGCCCTACCAGCGCCGGGGTGCCC
TGCAGCTGTGGCAATTTCTGGTGGCCTTGCTGGATGACCCAACAAATGCCCATTTCATTG
CCTGGACGGGCCGGGGAATGGAGTTCAAGCTCATTGAGCCTGAGGAGGTCGCCAGGCTCT
GGGGCATCCAGAAGAACCGGCCAGCCATGAATTACGACAAGCTGAGCCGCTCGCTCCGAT
ACTATTATGAGAAAGGCATCATGCAGAAGGTGGCTGGTGAGCGTTACGTGTACAAGTTTG
TGTGTGAGCCCGAGGCCCTCTTCTCTTTGGCCTTCCCGGACAATCAGCGTCCAGCTCTCA
AGGCTGAGTTTGACCGGCCTGTCAGTGAGGAGGACACAGTCCCTTTGTCCCACTTGGATG
AGAGCCCCGCCTACCTCCCAGAGCTGGCTGGCCCCGCCCAGCCATTTGGCCCCAAGGGTG
GCTACTCTTACTAGCCCCCAGCGGCTGTTCCCCCTGCCGCAGGTGGGTGCTGCCCTGTGT
ACATATAAATGAATCTGGTGTTGGGGAAACCTTCATCTGAAACCCACAGATGTCTCTGGG
GCAGATCCCCACTGTCCTACCAGTTGCCCTAGCCCAGACTCTGAGCTGCTCACCGGAGTC
ATTGGGAAGGAAAAGTGGAGAAATGGCAAGTCTAGAGTCTCAGAAACTCCCCTGGGGGTT
TCACCTGGGCCCTGGAGGAATTCAGCTCAGCTTCTTCCTAGGTCCAAGCCCCCCACACCT
TTTCCCCAACCACAGAGAACAAGAGTTTGTTCTGTTCTGGGGGACAGAGAAGGCGCTTCC
CAACTTCATACTGGCAGGAGGGTGAGGAGGTTCACTGAGCTCCCCAGATCTCCCACTGCG
GGGAGACAGAAGCCTGGACTCTGCCCCACGCTGTGGCCCTGGAGGGTCCCGGTTTGTCAG
TTCTTGGTGCTCTGTGTTCCCAGAGGCAGGCGGAGGTTGAAGAAAGGAACCTGGGATGAG
GGGTGCTGGGTATAAGCAGAGAGGGATGGGTTCCTGCTCCAAGGGACCCTTTGCCTTTCT
TCTGCCCTTTCCTAGGCCCAGGCCTGGGTTTGTACTTCCACCTCCACCACATCTGCCAGA
CCTTAATAAAGGCCCCCACTTCTCCCATTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAA

Protein Sequence

>2118 : length: 485
MERRMKAGYLDQQVPYTFSSQKSPGNGSLREALIGPLGKLMDPGSLPPLDSEDLFQDLSH
FQETWLAEAQVPDSDEQFVPDFHSENLAFHSPTTRIKKEPQSPRTDPALSCSRKPPLPYH
HGEQCLYSSAYDPPRQIAIKSPAPGALGQSPLQPFPRAEQRNFLRSSGTSQPHPGHGYLG
EHSSVFQQPLDICHSFTSQGGGREPLPAPYQHQLSEPCPPYPQQSFKQEYHDPLYEQAGQ
PAVDQGGVNGHRYPGAGVVIKQEQTDFAYDSDVTGCASMYLHTEGFSGPSPGDGAMGYGY
EKPLRPFPDDVCVVPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNAHF
IAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYK
FVCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFGPK
GGYSY