ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2117

Name

ETV3

Synonym

METS|PE-1|PE1|bA110J1.4;ets variant 3;ETV3;ets variant 3

Definition

ETS domain transcriptional repressor PE1|ETS translocation variant 3|ets variant gene 3, ETS family transcriptional repressor|mitogenic Ets transcriptional suppressor

Position

1q21-q23

Gene Type

protein-coding

Pathways and Diseases

Pathway

mets affect on macrophage differentiation;PID BioCarta;100169

Pathway

PDGF signaling pathway;PANTHER;P00047

Disease

Attention deficit hyperactivity disorder and conduct disorder;GAD

Disease

PSYCH;GAD

External Links

Links to cell senescence gene database

2117

Links to epithelial mesenchymal transition gene database

2117

Links to ovarian cancer gene database

2117

Links to endometrial cancer gene database

2117

Links to iHOP

2117

Sequence Information

Nucleotide Sequence

>2117 : length: 5459
GGCCGGGAGGAGCGCGCAGGGGGAGGAGTGCGGGCGGAAGTCGGCGTCTGCTGAAAGGAG
AAAGGAAAGGGAGACGCTGCTGGGTGCGGCGAGGTGAGGCTGGGAACCGGCGGGAGGGCG
CCTCCTCCTCCCCCGCCCTCTCTGCTGAGGATGGAAGTGACGAAAGCAGCCGAGGAGGTC
ACTTCCTGCTGGGGTGGATGAGGAGGAGCCGGAGACGCCGCGGAGGAGACCGGACCGAAG
ACGGACCGTGCCGGGAAGAGGCGGGTGAAAATGAAAGCCGGCTGTAGCATCGTGGAAAAG
CCAGAAGGAGGTGGAGGGTATCAGTTTCCTGACTGGGCCTACAAAACAGAGTCATCCCCA
GGCTCCCGGCAGATCCAGCTGTGGCACTTCATCCTGGAGCTGCTGCAGAAGGAAGAGTTC
CGCCATGTCATCGCCTGGCAGCAGGGAGAGTACGGGGAATTTGTCATCAAGGATCCAGAT
GAGGTGGCCCGCCTCTGGGGCCGCAGGAAATGCAAACCACAGATGAATTATGACAAGCTG
AGCCGGGCCCTCAGATACTATTACAACAAGAGGATCCTTCATAAAACAAAAGGGAAAAGA
TTTACCTATAAATTTAACTTCAACAAGCTGGTGATGCCCAACTACCCATTCATCAACATT
CGGTCAAGTGGTGTGGTTCCTCAGAGTGCACCACCAGTGCCAACAGCCTCTTCCCGGTTC
CATTTCCCACCTCTGGACACCCATTCTCCAACCAATGATGTGCAGCCGGGACGGTTCTCT
GCTAGCTCCCTAACTGCTTCTGGCCAGGAGTCCAGTAATGGTACTGATAGAAAGACTGAG
CTTTCAGAGCTGGAGGATGGCTCAGCTGCTGACTGGCGCCGGGGTGTGGATCCCGTGTCC
TCCAGGAATGCCATTGGTGGAGGAGGGATTGGCCATCAGAAACGCAAGCCTGACATAATG
CTTCCTCTGTTTGCTAGGCCAGGGATGTACCCTGACCCCCACAGTCCCTTCGCTGTCTCT
CCAATCCCTGGCCGCGGAGGTGTCCTTAATGTCCCCATTTCACCAGCCCTCTCCCTGACT
CCCACCATCTTCTCCTATAGCCCATCACCAGGCCTGAGCCCTTTCACCAGCAGCAGCTGC
TTCTCCTTCAACCCTGAGGAAATGAAACACTACCTTCATTCTCAAGCTTGTTCTGTGTTC
AACTACCATCTGAGTCCTCGGACTTTTCCCCGTTACCCAGGGCTCATGGTTCCACCACTG
CAGTGCCAAATGCATCCTGAGGAGTCAACTCAGTTCTCCATCAAGCTGCAGCCCCCACCA
GTTGGGCGGAAGAACCGGGAGAGGGTTGAGAGCAGCGAGGAGTCAGCACCAGTCACCACG
CCCACCATGGCTTCTATTCCCCCAAGAATCAAGGTGGAACCTGCCTCTGAAAAGGATCCT
GAGAGCCTCAGGCAGTCGGCACGAGAGAAGGAGGAGCACACTCAAGAAGAGGGCACTGTG
CCAAGCAGGACCATTGAAGAGGAAAAAGGCACCATCTTTGCCCGTCCTGCTGCACCACCC
ATCTGGCCCTCTGTGCCCATTAGCACCCCAAGTGGAGAACCTCTGGAGGTGACTGAAGAC
AGTGAGGATAGGCCTGGCAAAGAGCCCAGTGCACCTGAGAAGAAAGAAGATGCACTGATG
CCCCCCAAGCTTCGGTTGAAGCGGCGCTGGAATGATGACCCTGAAGCCCGAGAGCTGAGC
AAGAGTGGCAAGTTTCTCTGGAATGGGTCAGGACCCCAGGGCTTGGCAACAGCAGCTGCT
GATGCTTAGAACTGGAAGTGGATTAGGAGCTGTTTATACTATAATCAAATACATACATGT
ATTTATGTAGCAAGATTTCAGGGTGGGGGGGAGGGAGTTAAACTGGTTTGATCATTCTAG
GGGCATAGACTTGTATTTTTATGTTTTGGGGATGGGATGGGGTTATCTTCTGTTGTAAAT
TAGGTGGGATATGAACACACTTATTTTCCTGGTGAGTAGGACACAGGGAGGGTATTGAAC
TCAAAGGAGAAGGAGCCTCTATTTCCTGTTGAGGCTTATACTTTCTGACAAGGAAACTCC
CAAAGGGCCAAGATACTTTTTGGTCCCATGATAGTCAGGTTCCAGACTTCTTTCTTTTCT
ATTGTATTTGTATGTGGAAAGCCATTAATGAATTTATTTTACTCCAAGAGATACACATAA
AAGGGAAAAGGGCATGGTTGGGAGGTTGAGCAGTAAGAGACCATTAATACTAAGTATTTT
GCCTGAAATGCTTCTTTATAATTATTTCAGGGAAGGAATAAGATAATCTCAGACTTACTG
GGGTGGGGCTTGGGGAATGTTTGGATGTTGCTCTTTTTCTTCTTCCTTCTTTTTTTTTTT
TTTTTTTTTTTGGTTGGTGTTGTTTGGCATTTTTTTCTTTTCCTTTTTAAAGAAAATGTT
TTCAGGAAACATGAACAAACATACTGCCAATTATAGTGGGGCTGGGAAGGCACAGGAGCT
GGCGACCTCTCAGCTGCATAGTTGGGACGGCAAACCCTGCTGTGAGCTTCTCAGACTTTT
CACCTACTTCACCTATTAAGAAGCCATGAGGAGTTGTAAACTCTTGTTCAGGGAAGAAAA
GAGGGCAGGAGGAAGTAACCCAATGCCTTTAAATACAAAACAGATGAAAAACAAAATACT
CATTTTTCCTTTTCTATTGTGGGTTTGGGGAGCCAAACCAAGTGTGACTGTGAGCACGTT
CACTGAGAGGCATGACAACATTATTGAAGAGGTCTTTCCATTATGTCTGGTTCTCTTATT
TTCTTAAGTCAAGCCTTAACTATGAACATACTTTAAGATGATACGGGTCTGTCACCATAA
ACCTGTAAAAGGGCATCGACAGCTTTTCAGATAATCCAGGAATGTTGAGACATGGCTAAG
TTTCTAGCTGATACTTAGTCATTCCCTCTTGATATTGTTGGGATGGGTAGCCAAAAGGCA
GGCTTGTGGGAGTTAAGAGCCAATGATACCTGGAAACATGGGAGGTAGCTGGGGGTACAA
GTGGATGTTGAGACTGAAGGAAGAGGTGGAAAGAAGACACAGAAGGCACCCAGATGCCAA
AAGGCCTGGCATGAATGAGAGTTGGCATCTGTCCTGTTGTGGTGTTCCCATTCTTGCCAT
ACCCATTTGCCCAGATTGTTCTGATTCTCATGTTCAATTGACTATCCCACATGAGACTAC
AGTTTATAGGCAGTGAGGAATTGTTTCTTCCTGGGAAATGTCCTTCCAGCAACTTCAGAG
GAATGGGAAAGTGTTAATCTTACGTGAAGCAAAGGAGCCTGGACTAGGGGCAGAGAGAAA
GAAGCAGCAGCCCACCTTCTTTGTGTTTGCACATGTGCCTATGTCGTGTACATTGGTACC
TGACTGTGGCTCAGATCTGCGTCGCAGCAGCGAGAGAAGAAATCACTCCATATCCGATGA
GAGGAAGGGTGGCACAGAGATGGTGTCTACAATTAGAGACATTTCTGACTCCACCTTAGC
CTAAGCAAACTTTATATACTGAGTAACATTTGAAGGTTGTCTTTTAATGGTGGGGGGTGT
TTTTTCCTTTTTAAACTACAGTGCTTGCACAAGAGAGGGAGGGACTCAGAAAAGGTTAGG
GCAGGTGAGGGAGACAGTAGATGGCCTGGGATGACTTGAGTCCATCATACTATTGCTTGG
CAGGTGTCCTCCCCCATGTTTGATTCAAATTCCATGAGTGACCTACCTTTCCCCAGGAAT
GGGACTGAGAGGGTAGTCTCCAGCAACTCAGTCTGCACAGGGCTCCCCGTTCAGGCTGCC
TTTGGTGGTTGTGCTTTTGTAAGTTTCTTTCTCTGCACTTCGACTTACCTCTGAATCAGA
AAGCAAGCCCAGCAGGTGAATGAGGGATGTCTGCTTGGCATTGCCCAATCTAACCAGGGA
GGCTGGCTGGCCACCCACTGTCCGCTAGAGGGGAGAGCTAGCAGGTGTTGGTATGAACTC
AGGAATAGAAACACGAGGCCTTTTTAAATACGAGGGAGAAGAATCCATGATGCATACCTG
TAACCCCCTAGAACCCAAGTGCCAGAATTCCTAGATGCTGCTTCTGTTTGAACAAAATGT
CACTGCTTTTACACTTGAAAAAAACACACTCGAAAAATGTTCAACTCCATGAAAAATATT
TTTTGGCTTTAAGAAATTGTTTGGTGTTTAACTGTTTCCTTTGATTGCCATTCCACCAGT
AAATTGTTGGTTGATTTGCACTGCACTCTGGGGTTGGGGTTGGGAGGGGAGGGTCCTTAT
ACAGAGCCGAACCTGGGGTTGCTCAGGAAGTGGGCCAGGGAATGTGGAAGTCGTTGACAT
TGCCTGGGCCAAAAGAGTGGGAGATAGTTTTTCTCCCCTCAGCCCACTCCTGGTAGCACC
TGTCGCCAGCCTGGTACAAAGCCAGGCCTTTTTCTTCTGTGAGCATCTCATCACTGTCCA
GCAGCAGGTGGAAAAAGGGGGACAACAACCAGACCTATTTTTTCTCCCCCATTTTTTCCA
AATTTTGCTGTGCCAAATGTTTAAAATTTTATAAATATGAATCTATTGAAATTTCCTTAA
TCAAGAGCTTCTTCGTGTAAAGTTTGCTTTTTTAGCTATAGAAAAAGAAAACAGTAAATA
TCTCTTAATGGCATCCAGCCTTGCTGAGCTCACCTTTTTTCCTGAAGAATGGGTAGGAGT
GAAATATTTAATGTAAACATTTCACCAAGTCCCTTTACCCTAATTTTGAAGCTGCATTAA
ACCCAACTCACTAACACAGGGAATGATTGCACCCTAGTCCTCTGTGGGCCAAGAAACTTT
CAGAAGCATTAAAAAAATAGTTGAAGTATATCACTTCTCACCAAGTGGGTAGAGTCAGTT
GGCTGTTTGTCCCTTGTTTTTTATTTATTCCATAATTATGTTTGTGCTTTTTGTTTTGTA
AACAGTAATGGAACGTACATTTTTATTTTGTTTAGAAGACAACTTTGATTCAATCTTTCA
AGAACTGTTCCATTCTTGGTTTCTTCTTAGGGGGATAAAAAGTTACCAGTTAATTTGTTT
TGAGATATTTAAGCATTCTTTGAGTTATAGAATTGTGATGCAGGGATTTGTGAATGAGAC
ATTTACATGTGAAAGGTGACTTCACTAGTTACCTGCTTGAGCAGAGTAAAGTGTGTATAT
GTACATAAAATGTAAGTAATCTTAACTCCATTGTGCAGTGCCTTTTAGATGTTCCGCTTT
CTATAAAGTCTTCAAATTTTTGCATATATATTATATATATATGATGTAATGTTATAGAAA
TATATGTATAATATACATATTTTTTCCAGGGGTATCTGATAGCTCTGTATTTTGTTATGG
AAGTTGAAAGAAAAAAGTATTTTACCTCAGAAATTAAATAAAAAAATACTTTTAAGTAA

Protein Sequence

>2117 : length: 512
MKAGCSIVEKPEGGGGYQFPDWAYKTESSPGSRQIQLWHFILELLQKEEFRHVIAWQQGE
YGEFVIKDPDEVARLWGRRKCKPQMNYDKLSRALRYYYNKRILHKTKGKRFTYKFNFNKL
VMPNYPFINIRSSGVVPQSAPPVPTASSRFHFPPLDTHSPTNDVQPGRFSASSLTASGQE
SSNGTDRKTELSELEDGSAADWRRGVDPVSSRNAIGGGGIGHQKRKPDIMLPLFARPGMY
PDPHSPFAVSPIPGRGGVLNVPISPALSLTPTIFSYSPSPGLSPFTSSSCFSFNPEEMKH
YLHSQACSVFNYHLSPRTFPRYPGLMVPPLQCQMHPEESTQFSIKLQPPPVGRKNRERVE
SSEESAPVTTPTMASIPPRIKVEPASEKDPESLRQSAREKEEHTQEEGTVPSRTIEEEKG
TIFARPAAPPIWPSVPISTPSGEPLEVTEDSEDRPGKEPSAPEKKEDALMPPKLRLKRRW
NDDPEARELSKSGKFLWNGSGPQGLATAAADA