ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2115

Name

ETV1

Synonym

ER81;ets variant 1;ETV1;ets variant 1

Definition

ETS translocation variant 1|ets variant gene 1|ets-related protein 81

Position

7p21.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

p38 signaling mediated by MAPKAP kinases;PID Curated;200135

Disease

Cancers of soft tissues and bone;KEGG DISEASE

Disease

Breast cancer;FunDO

Disease

Cancers;KEGG DISEASE

Disease

Ewing's sarcoma;KEGG DISEASE;H00035

Disease

Prostate cancer;FunDO

External Links

Links to cell senescence gene database

2115

Links to epithelial mesenchymal transition gene database

2115

Links to ovarian cancer gene database

2115

Links to endometrial cancer gene database

2115

Links to iHOP

2115

Sequence Information

Nucleotide Sequence

>2115 : length: 6824
AAGGAAACCAGCCCAATAGTGGACCTAACACCCCAATAATGGGAACTGGCGACTCGAAAC
ACACGGTTTCAGTATCCCCAGGCGCCTTAACAATAAGCAGCGGGTTACAGAGGAAATCGA
GTCTCTCCGTGGCGCTTCCAGGCTGAGGACCCAGCGCCTACCGGCCGAGCACCCCCTAGG
GCAGAGGGGCGAGGGAGACCCGCGGGAAGGGGCAGCAAGCCGCCTGATTGACAGCCCGAA
ATCTGATCTTGTGAAAGAGACGCGGAGCCAATGGGAGGCAGCGATCCATCAGTTTGGATT
GGAGGCCCCTGGAGGAGAAGTAGAGGAAAAACCACCGAATTGAGCTCTGTCAGAGGCGCT
TTCGGCTTCCAAGGGGGAAGTGCTGGGCTATAATTAATGTTTTTATTAAATTTGGAGGGA
AGTTTTTGCAGCCTTTCGCCTAGCGTGGCCTTCAGTCCCGTTAGGTGCAAAGCAAGTCTC
GTTGATCGCCATTGCTAGTTTTGCACACGTTTGCGAATCAGAGCTGCCCGGGGTACACCG
ACCGCGCAGGGAAACATCGAGAGTGTAAATAAATACATCGCCTCTTGTTCGGATTTTTGC
TACTACCGAAAATATGTAAATTGTGAACTCTGTTGGCTCTCTTTGGATCCAGGTTGATAG
AAGTCCAGATCCTGAGGAAATCTCCAGCTAAATGCTCAAAATATAAAATACTGAGCTGAG
ATTTGCGAAGAGCAGCAGCATGGATGGATTTTATGACCAGCAAGTGCCTTACATGGTCAC
CAATAGTCAGCGTGGGAGAAATTGTAACGAGAAACCAACAAATGTCAGGAAAAGAAAATT
CATTAACAGAGATCTGGCTCATGATTCAGAAGAACTCTTTCAAGATCTAAGTCAATTACA
GGAAACATGGCTTGCAGAAGCTCAGGTACCTGACAATGATGAGCAGTTTGTACCAGACTA
TCAGGCTGAAAGTTTGGCTTTTCATGGCCTGCCACTGAAAATCAAGAAAGAACCCCACAG
TCCATGTTCAGAAATCAGCTCTGCCTGCAGTCAAGAACAGCCCTTTAAATTCAGCTATGG
AGAAAAGTGCCTGTACAATGTCAGTGCCTATGATCAGAAGCCACAAGTGGGAATGAGGCC
CTCCAACCCCCCCACACCATCCAGCACGCCAGTGTCCCCACTGCATCATGCATCTCCAAA
CTCAACTCATACACCGAAACCTGACCGGGCCTTCCCAGCTCACCTCCCTCCATCGCAGTC
CATACCAGATAGCAGCTACCCCATGGACCACAGATTTCGCCGCCAGCTTTCTGAACCCTG
TAACTCCTTTCCTCCTTTGCCGACGATGCCAAGGGAAGGACGTCCTATGTACCAACGCCA
GATGTCTGAGCCAAACATCCCCTTCCCACCACAAGGCTTTAAGCAGGAGTACCACGACCC
AGTGTATGAACACAACACCATGGTTGGCAGTGCGGCCAGCCAAAGCTTTCCCCCTCCTCT
GATGATTAAACAGGAACCCAGAGATTTTGCATATGACTCAGAAGTGCCTAGCTGCCACTC
CATTTATATGAGGCAAGAAGGCTTCCTGGCTCATCCCAGCAGAACAGAAGGCTGTATGTT
TGAAAAGGGCCCCAGGCAGTTTTATGATGACACCTGTGTTGTCCCAGAAAAATTCGATGG
AGACATCAAACAAGAGCCAGGAATGTATCGGGAAGGACCCACATACCAACGGCGAGGATC
ACTTCAGCTCTGGCAGTTTTTGGTAGCTCTTCTGGATGACCCTTCAAATTCTCATTTTAT
TGCCTGGACTGGTCGAGGCATGGAATTTAAACTGATTGAGCCTGAAGAGGTGGCCCGACG
TTGGGGCATTCAGAAAAACAGGCCAGCTATGAACTATGATAAACTTAGCCGTTCACTCCG
CTATTACTATGAGAAAGGAATTATGCAAAAGGTGGCTGGAGAGAGATATGTCTACAAGTT
TGTGTGTGATCCAGAAGCCCTTTTCTCCATGGCCTTTCCAGATAATCAGCGTCCACTGCT
GAAGACAGACATGGAACGTCACATCAACGAGGAGGACACAGTGCCTCTTTCTCACTTTGA
TGAGAGCATGGCCTACATGCCGGAAGGGGGCTGCTGCAACCCCCACCCCTACAACGAAGG
CTACGTGTATTAACACAAGTGACAGTCAAGCAGGGCGTTTTTGCGCTTTTCCTTTTTTCT
GCAAGATACAGAGAATTGCTGAATCTTTGTTTTATTTCTGTTGTTTGTATTTTATTTTTA
AATAATAATACACAAAAAGGGGCTTTTCCTGTTGCATTATTCTATGGTCTGCCATGGACT
GTGCACTTTATTTGAGGGTGGGTGGGAGTAATCTAAACATTTATTCTGTGTAACAGGAAG
CTAATGGGTGAATGGGCAGAGGGATTTGGGGATTACTTTTTACTTAGGCTTGGGATGGGG
TCCTACAAGTTTTGAGTATGATGAAACTATATCATGTCTGTTTGATTTCATAACAACATA
AGATAATGTTTATTTTATCGGGGTATCTATGGTACAGTTAATTTCACGTTGTGTAAATAT
CCACTTGGAGACTATTTGCCTTGGGCATTTTCCCCTGTCATTTATGAGTCTCTGCAGGTG
TACAAAAAAACCCCAATCTACTGTAAATGGCAGTTTAATTGTTAGAAATGACTGTTTTTG
CACCACTTGTAAAAAGGTATTTAGCGATTGCATTTGCTGTTTGTTGTTTTATTTTGCTTT
ATATATGACTTGCAGAGGATAACCATAAAATGGGTAATTCTCTCTGAAGTTGAATAATCA
CCATGACTGTAAATGAGGGGCACAATTTTGGACTCTGGCGCCAAACTGAGTCATAGGCCA
GTAGCATTACGTGTATCTGGTGCCACCTTGCTGTTTAGATACAAATCATACCGTCTTTTA
AATATTTTGAAGCCCATTTCAGTTAAATAATGACATGTCATGGTCCTTTGGAATCTTCAT
TTAAATGTTAAATCTGGAATCAAAATGAAGCAAAAAATATCTGTCTCCTTTTCACTTTCT
TCAGTACATAAATACATTATTTAATCAATAAGAATTAACTGTACTAAATCATGTATTATG
CTGTTCTAGTTACAGCAAACACTCTTTAAGAAAAATATCCAATACACTAAATAGGTACTA
TAGTAATTTTTAGACATGGTACCCATTGATATGCATTTAAACCTTTTACTGCTGTGTTAT
GTTGATAACATATATAAATATTAGATAATGCTAATGCTTCTGCTGCTGTCTTTTCTGTAA
TATTCTCTTTCATGCTGAATTTACTATGACCATTTATAAGCAGTGCAGTTAACTACAGAT
AGCATTTCAGGACAAAATAGATGACTCAAACCATTTATTGCTTAAAAAATAGCTTACGCC
ATGCTATGCTATAAGCAGCTTTTATGCACATTGACAAATGAAGAGTAAGCTTCAGCTTGC
TAAAGGAAACTGTGGAACCTTTTGTAACTTTTGGTGATATGGAAAATTATTTACAAACCG
TCAAAGAATATGAGGAAGTTGCTGTATGACATAGTGCTGGCACTGATATTATCCATCATC
TCTTTTTGGACACTTCTGTAAATGTGATTGGATTGTTTGAAAGAAGATTTAAAGTTTCAA
AGTTTTTTGTTCTGTTTTTGCTTTGCATTTGGAGAAAATATTGAAAGCAGGGTATGTTGT
TTCATTCACCTTGAAAAAACCATGAGTAAATGGGGATATAGAATCTCTGAATAGCTCGCT
AAAAGATTCAAGCAAGGGACATGAATTTTGTTCCATCTATCAATAATATCCAGAAGAACA
ACTTTTTTAAAGAGTCTATAGCAAAAAGCAAAAAAAAAAAAAAATTCTAAACACAAAGTC
AAAATAAACCTATTGTAAAAGCATTTCGTGATGAGCATGAAAAAGATTGTTTAAAGATGA
TCCCCCCAGCTACCCATTTTCCAAAACTACACAGATCACAGCTCATTTCTCTAAGTGGAG
CAGTTATCAAGAAACCCAAACACCAAAATTGCTACTCTTCACATTTAATCCTACAAAAAG
TACTCCAATTTCAAAATATGTATGTAACCTGCGATTTCAATGATTGTTGTTCATATACAT
CATGTATTATTTTGGCCCATTTTGGGCCTAAAAAAGAAAACTATGCCTTAAAAATCAGAA
CCTTTTCTCCCCACTATGCTTATGTGGCCATCTACAGCACTTAGAATAAAAACAGATGTT
AAAATATTCAGTGAAAGTTTTATTGGAAAAAGGAATTGAGATATATAATTGAGATTTGGT
GAAATTGAAGGAGAAAATTTAAGTGAGTCTTTAAAATATATTCTGAATGAAAACTGTATT
GAGGATTCATTTTTGTTCCTTTTTTTTCTTTTTCTCTTTTCTCCTTTTTCTTCTTTTTAA
TAGTCTAGTTTTAGTCAGTCAGTGAGGAAGAATTGGGCCATGCTAACGTTATCACAAGAG
AACAATGGCAGAAATGGTATTAGTTATATAATATTTAAGGACAAACTATATGTTTTGCTG
TTTTAACGTAGTGACTCACTGAACTAAATACATAATTGACCAACATTAAGTGTATTTCCA
ATACAGAAGGGTTGAAAATATTACATTATAAACTCTTTTGAAAAATGTATCTAAAATTTT
TTAAGTTCTGTTTTGATTCCACTTTTTGGTTGAGTTTTTATGTTTTTGTTTTCAGGTAGA
TTAATAAATCTGGCAGCTGATTTCTGCAAGATTCTTGTGTTTTGAATTTCTCATTGAATT
GGCTACTCAAACATAGAAATCATTTGTTAATGATGTAATGTCTTCTCTCAGCTTTTATCT
TCACTGCTGTTTGCTGTCTCTTGATGATGACATGTTAATACCCAATAGATTAATTGCAAC
AAACACTTATACTCAAATAACTAAGTAAAAATAATTTTTCTTGTTATGTCCATGAAAAGT
GCTTCAGAATAAAAATCCACAAGACTGACAGTGCAGAACATTTTTCTCAAATCATGGGCG
GATCTTGGAGGTCTAGTTTCCCGTAGATGCTGTAACCAATTACCACAACTTCAGTAATTT
ACACAAATTTATCTTATAGTTCTGGAGGCAGAAGTTCAAAAGAAGCCTTAAGAGACTAAA
ACCAAGATGTCCTTAGGTCTGGTTCCTTCTGGAGGCTCCAGGGGAGATTCTTCCAGCTTT
CACTTCTAGAGTCTGCTGACATTCCTTGGCTCCTGGCTACATCACTTCAATCTCTGCTTC
CATGGTCACATACTCTTCTACTATAGTCAAATTTCCTTCCTGCCTCTTATAAGGATGCTT
GTGATTACATTTAGGGGATGCTCAGATAATCCAGGACAATCTCTCCATCTCAAGATCCTT
AACTTAATGACGTGTGCCAAGTCCCTTTGGCTAGATAATTATTCATAGGTCCCAGGGATT
AGGACATGGATGTAAGGGGTGAGGGCAGGGCTGTTATTCAGAACACCGCACGGAGGAGGA
AGACTGTGTAGCAAAGACTCTAATTGATTTACTCAGGAACAGTGGAGTTCTGCTGAGGGA
TCTAGGATTTGAAAGTACTAGAGTTTGCTTTTATTTACCACTGAGATATTTTCCCCTTAT
TCTGCATAAATAATTTTGAAAACTTTCTATATTAAATTTCAACTATTCCACTAAAATGTC
TGGTAATCACATCAAGCCTTTAGATTATTCAAATCCTTCCCCAGCCCCCAGGAAAACACT
AAGTCATGAAACAGAAAAACAGAAGGTATGATAATAATAGTAATAACAGTTAAATCAGTG
GTCTAATCCAGATTTTATTTTTTAATACATTTCTTTTGGTGTTAATATGGGTTACTATGT
GATCTTATCATTTGCTAGTGATTATTACTTATTAGGTAAGAACAATGTGTAAAATATGTC
TATTACTCAAAAGAACAATTGCAAAATGAGTCAACTTATCTTTATATAACCAGGAAAGAA
ATATATTGCCAGAAGCTACAGAATTTTGCCAGATGATAGGGATTTCTAAAATGAGCCACT
TTGTCTATCATGCAGCCTTTTCAGAGCTTGTAATGAGAAAACATTACAGAGGAGAAGGTC
ATTTGGATGTTTGTTACTTGGAATCCTAGAAAACAAAAACTAAAATTTAAAAATAAGAAG
TGAGTAAGCTATTTTCCATTTGCGATTTGGTATGGAGAAGAGAGGAAATAGAATTATTAA
AAAAATACAAATTGGGTAAAAGTGATGGTGGAAAAAATATAAAGAAGGCAAATGTACATA
TTAAGCAATTCTACTAAGAATTGGAAAAATCAAGTTTCAAAAAGATGGTAATAGTTGGGC
ATGATACTAGAAAATTTCACCCAGTTTATTCAGAGCTCAACTAGTACTTTTAGGACTTCT
TTTTTTATATACATGAGACTCACTTTGACATACTTAAAAAAAAAACAGTTTATGGAAAGT
ACAGTTTAAGAGGAGAATTTGATTAGACTAAGTGGATATCTTTATAGAAATATTAATGAT
TTCAGAATTTTCAGTTACAAGTGTATATACCGTGGCTATTGTTTATGGATTCATATGTAA
GGTAGGGTCTTTTTTGCATATAGACTCCAGTATTAGTTACTTTCATTCTAAAATTATATT
TATGCTTCTATGGGGAAGAAAATTTTTAATTCACTTGGTTGTATTAAAATTATACTTACG
GTTTGAGAAAACATGCTATGAAAATCATGATTATAGCAAATTAAATATGCTCAAAATTTA
AATCTAAAATAAAAGCCCAGAAACTGAAAAAAAAAAAAAAAAAA

Protein Sequence

>2115 : length: 491
MSGRGDGGQQQLLHSKFLAGFVCHIEKNESQRGRNCNEKPTNVRKRKFINRDLAHDSEEL
FQDLSQLQETWLAEAQVPDNDEQFVPDYQAESLAFHGLPLKIKKEPHSPCSEISSACSQE
QPFKFSYGEKCLYNVSAYDQKPQVGMRPSNPPTPSSTPVSPLHHASPNSTHTPKPDRAFP
AHLPPSQSIPDSSYPMDHRFRRQLSEPCNSFPPLPTMPREGRPMYQRQMSEPNIPFPPQG
FKQEYHDPVYEHNTMVGSAASQSFPPPLMIKQEPRDFAYDSEVPSCHSIYMRQEGFLAHP
SRTEGCMFEKGPRQFYDDTCVVPEKFDGDIKQEPGMYREGPTYQRRGSLQLWQFLVALLD
DPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVA
GERYVYKFVCDPEALFSMAFPDNQRPLLKTDMERHINEEDTVPLSHFDESMAYMPEGGCC
NPHPYNEGYVY