ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2114

Name

ETS2

Synonym

ETS2IT1;v-ets avian erythroblastosis virus E26 oncogene homolog 2;ETS2;v-ets avian erythroblastosis virus E26 oncogene homolog 2

Definition

oncogene ETS-2|protein C-ets-2|v-ets avian erythroblastosis virus E2 oncogene homolog 2|v-ets erythroblastosis virus E26 oncogene homolog 2

Position

21q22.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

mets affect on macrophage differentiation;PID BioCarta;100169

Pathway

C-MYB transcription factor network;PID Curated;200130

Pathway

Dorso-ventral axis formation;KEGG PATHWAY;hsa04320

Disease

Choriocarcinoma;FunDO

Disease

Breast cancer;FunDO

Disease

Bladder cancer;FunDO

Disease

Esophagus cancer;FunDO

External Links

Links to cell senescence gene database

2114

Links to epithelial mesenchymal transition gene database

2114

Links to ovarian cancer gene database

2114

Links to endometrial cancer gene database

2114

Links to iHOP

2114

Sequence Information

Nucleotide Sequence

>2114 : length: 3954
AGAATGATCATTAGTCCTAAGCCCATTCAGAGGTTCAAGAATGGGGTCGGCTCAATTTCA
GGGCCTTATTACCCAAGCCCGGCTGCCCTTCGGTGCCACCAGCACCACTGCTCCGTCGCT
GCGGAATTCCAAAGGCAGGTTTGGCGTTAGGGCCTTGGCCCCAGAGAGGACGCCGAGCGC
TCCACGGAAAGTCTCCGCCCGGCTCCCAGGGCGCACACTCGCGCGCACGTGGGGCCGAGG
CCCTGCTCCCGGGGCCTCAGGGCCAGCCGGCGAGGGACCCAGCCGAGTGACAGCAGGAGG
CGGAGGGAAGCTCAGAGCTCCCGGAGCCGCCCGGCCAGCGTCCGGCCTCCCTGATCGTCT
CTGGCCGGCGCCCTCGCCCTCGCCCGGCGCGCACCGAGCAGCCGCGGGCGCCGAGCAGCC
ACCGTCCCGACCAAGCGCCGGCCCTGCCCGCAGCGGCAGGATGAATGATTTCGGAATCAA
GAATATGGACCAGGTAGCCCCTGTGGCTAACAGTTACAGAGGGACACTCAAGCGCCAGCC
AGCCTTTGACACCTTTGATGGGTCCCTGTTTGCTGTTTTTCCTTCTCTAAATGAAGAGCA
AACACTGCAAGAAGTGCCAACAGGCTTGGATTCCATTTCTCATGACTCCGCCAACTGTGA
ATTGCCTTTGTTAACCCCGTGCAGCAAGGCTGTGATGAGTCAAGCCTTAAAAGCTACCTT
CAGTGGCTTCAAAAAGGAACAGCGGCGCCTGGGCATTCCAAAGAACCCCTGGCTGTGGAG
TGAGCAACAGGTATGCCAGTGGCTTCTCTGGGCCACCAATGAGTTCAGTCTGGTGAACGT
GAATCTGCAGAGGTTCGGCATGAATGGCCAGATGCTGTGTAACCTTGGCAAGGAACGCTT
TCTGGAGCTGGCACCTGACTTTGTGGGTGACATTCTCTGGGAACATCTGGAGCAAATGAT
CAAAGAAAACCAAGAAAAGACAGAAGATCAATATGAAGAAAATTCACACCTCACCTCCGT
TCCTCATTGGATTAACAGCAATACATTAGGTTTTGGCACAGAGCAGGCGCCCTATGGAAT
GCAGACACAGAATTACCCCAAAGGCGGCCTCCTGGACAGCATGTGTCCGGCCTCCACACC
CAGCGTACTCAGCTCTGAGCAGGAGTTTCAGATGTTCCCCAAGTCTCGGCTCAGCTCCGT
CAGCGTCACCTACTGCTCTGTCAGTCAGGACTTCCCAGGCAGCAACTTGAATTTGCTCAC
CAACAATTCTGGGACTCCCAAAGACCACGACTCCCCTGAGAACGGTGCGGACAGCTTCGA
GAGCTCAGACTCCCTCCTCCAGTCCTGGAACAGCCAGTCGTCCTTGCTGGATGTGCAACG
GGTTCCTTCCTTCGAGAGCTTCGAAGATGACTGCAGCCAGTCTCTCTGCCTCAATAAGCC
AACCATGTCTTTCAAGGATTACATCCAAGAGAGGAGTGACCCAGTGGAGCAAGGCAAACC
AGTTATACCTGCAGCTGTGCTGGCCGGCTTCACAGGAAGTGGACCTATTCAGCTGTGGCA
GTTTCTCCTGGAGCTGCTATCAGACAAATCCTGCCAGTCATTCATCAGCTGGACTGGAGA
CGGATGGGAGTTTAAGCTCGCCGACCCCGATGAGGTGGCCCGCCGGTGGGGAAAGAGGAA
AAATAAGCCCAAGATGAACTACGAGAAGCTGAGCCGGGGCTTACGCTACTATTACGACAA
GAACATCATCCACAAGACGTCGGGGAAGCGCTACGTGTACCGCTTCGTGTGCGACCTCCA
GAACTTGCTGGGGTTCACGCCCGAGGAACTGCACGCCATCCTGGGCGTCCAGCCCGACAC
GGAGGACTGAGGTCGCCGGGACCACCCTGAGCCGGCCCCAGGCTCGTGGACTGAGTGGGA
AGCCCATCCTGACCAGCTGCTCCGAGGACCCAGGAAAGGCAGGATTGAAAATGTCCAGGA
AAGTGGCCAAGAAGCAGTGGCCTTATTGCATCCCAAACCACGCCTCTTGACCAGGCTGCC
TCCCTTGTGGCAGCAACGGCACAGCTAATTCTACTCACAGTGCTTTTAAGTGAAAATGGT
CGAGAAAGAGGCACCAGGAAGCCGTCCTGGCGCCTGGCAGTCCGTGGGACGGGATGGTTC
TGGCTGTTTGAGATTCTCAAAGGAGCGAGCATGTCGTGGACACACACAGACTATTTTTAG
ATTTTCTTTTGCCTTTTGCAACCAGGAACAGCAAATGCAAAAACTCTTTGAGAGGGTAGG
AGGGTGGGAAGGAAACAACCATGTCATTTCAGAAGTTAGTTTGTATATATTATTATAATC
TTATAATTGTTCTCAGAATCCCTTAACAGTTGTATTTAACAGAAATTGTATATTGTAATT
TAAAATAATTATATAACTGTATTTGAAATAAGAATTCAGACATCTGAGGTTTTATTTCAT
TTTTCAATAGCACATATGGAATTTTGCAAAGATTTAATCTGCCAAGGGCCGACTAAGAGA
AGTTGTAAAGTATGTATTATTTACATTTAATAGACTTACAGGGATAAGGCCTGTGGGGGG
TAATCCCTGCTTTTTGTGTTTTTTTGTTTGTTTGTTTGTTTGTTTTTGGGGGGTTTTCTT
GCCTTGGTTGTCTGGCAAGGACTTTGTACATTTGGGAGTTTTTATGAGAAACTTAAATGT
TATTATCTGGGCTTATATCTGGCCTCTGCTTTCTCCTTTAATTGTAAAGTAAAAGCTATA
AAGCAGTATTTTTCTTGACAAATGGCATATGTTTTCCACTTCTTTGCATGCGTTTAAGTC
AGTTTATACACAAAATGGATTTTATTTTTTAGTTTAACTGTGTTTCTCCGACAGCTCACC
TCTCTCTGACCACCCAGCCATTTCCTTCCTGTGCTCCACGTTCTTCTGTGTGATTAAAAT
AAGAATATTATTTTTGGAAATATGCAACTCCTTTTCAGAGATCAGGAGGGATTTATGTAG
CAGCTATTTTTACTGCAAAAGTAATTCACTGGAAAAAAAATGTAATTTGTAAGAAAGCTT
TATTTTTATCTCAGCTCTATGTAAAGTTAAAGTTACTGTACAGAGCTGAAGGACGGGGGG
CGGTAGGGGTCTTGATGAAACCTCTTGAACGAAGCACAGTTTGTCCCATCTTTGTTCACT
CGTGTGTCTCAACCATCTTAATAGCATGCTGCTCCTTTTTGCTCAGTGTCCACAGCAAGA
TGACGTGATTCTTATTTTCTTGGACACAGACTATTCTGAGGCACAGAGCGGGGACTTAAG
ATGGGAAAGAGAAAGCATCGGAGCCATTCATTCGGAGAAAACGTTTTGATCAAAATGGAG
ACTTTTGTAGTCGTTTCAAAAGAGCACCTGAGTCATGTGTATTCCCGGCCTTTATAAATG
ACCCGGTCAAGTTGGTTTCAAAGTCCGACAGGCTTGTCTGTTTACTAGCTGCGTGGCCTT
GGACGGGTGGCTGACATCTGTAAAGAATCCTCCTGTGATGAAACTGAGGAATCGGGTGGC
CGGGCAAGCTGGGAAGAGCAAAGCCAGAGCTGCGCTGCCTCAATACCCACAAAAGACCAT
TCCCAGTATACATAAGCACAGGATGTTTTTCTCAAGAGGGATGTATTTATCACTTGGACA
TCTGTTTATAATATAAACAGACATGTGACTGGGAACATCTTGCTGCCAAAAGAATCCTAG
GCAGTGGCTCATTGTATGTGAGGTTGAACCACGTGAAATTGCCAATATTAGGCTGGCTTT
TATCTACAAAGAAGGAGTTTCATGGGGTTCAGCCTAACAGTTATGGAAACTACAGTCCTT
ATAAACCATTGGCATGGTAATAAACAGATCTTAAGTATAAAAATTTTGTAATTGGGCCTT
TACTCTCTCAATAATAAAGTATTTTGTTTATATAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>2114 : length: 609
MGSAQFQGLITQARLPFGATSTTAPSLRNSKGRFGVRALAPERTPSAPRKVSARLPGRTL
ARTWGRGPAPGASGPAGEGPSRVTAGGGGKLRAPGAARPASGLPDRLWPAPSPSPGAHRA
AAGAEQPPSRPSAGPARSGRMNDFGIKNMDQVAPVANSYRGTLKRQPAFDTFDGSLFAVF
PSLNEEQTLQEVPTGLDSISHDSANCELPLLTPCSKAVMSQALKATFSGFKKEQRRLGIP
KNPWLWSEQQVCQWLLWATNEFSLVNVNLQRFGMNGQMLCNLGKERFLELAPDFVGDILW
EHLEQMIKENQEKTEDQYEENSHLTSVPHWINSNTLGFGTEQAPYGMQTQNYPKGGLLDS
MCPASTPSVLSSEQEFQMFPKSRLSSVSVTYCSVSQDFPGSNLNLLTNNSGTPKDHDSPE
NGADSFESSDSLLQSWNSQSSLLDVQRVPSFESFEDDCSQSLCLNKPTMSFKDYIQERSD
PVEQGKPVIPAAVLAGFTGSGPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVA
RRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCDLQNLLGFTPEELHAI
LGVQPDTED