ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2113

Name

ETS1

Synonym

ETS-1|EWSR2|p54;v-ets avian erythroblastosis virus E26 oncogene homolog 1;ETS1;v-ets avian erythroblastosis virus E26 oncogene homolog 1

Definition

Avian erythroblastosis virus E26 (v-ets) oncogene homolog-1|protein C-ets-1|v-ets avian erythroblastosis virus E2 oncogene homolog 1

Position

11q23.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

BCR signaling pathway;PID Curated;200005

Pathway

Angiopoietin receptor Tie2-mediated signaling;PID Curated;200066

Pathway

IL4-mediated signaling events;PID Curated;200018

Pathway

mets affect on macrophage differentiation;PID BioCarta;100169

Pathway

VEGF signaling pathway;PANTHER;P00056

Pathway

Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032

Pathway

PDGF signaling pathway;PANTHER;P00047

Pathway

Signaling events mediated by focal adhesion kinase;PID Curated;200192

Pathway

HIF-1-alpha transcription factor network;PID Curated;200172

Pathway

HIF-2-alpha transcription factor network;PID Curated;200030

Pathway

C-MYB transcription factor network;PID Curated;200130

Pathway

Angiogenesis;PANTHER;P00005

Pathway

AP-1 transcription factor network;PID Curated;200118

Pathway

Ras Pathway;PANTHER;P04393

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Renal cell carcinoma;KEGG PATHWAY;hsa05211

Pathway

Dorso-ventral axis formation;KEGG PATHWAY;hsa04320

Disease

IMMUNE;GAD

Disease

Celiac disease;NHGRI

Disease

Celiac Disease;GAD

Disease

Asthma;FunDO

Disease

Cancer;FunDO

Disease

Systemic lupus erythematosus;NHGRI

Disease

systemic lupus erythematosus;GAD

External Links

Links to cell senescence gene database

2113

Links to epithelial mesenchymal transition gene database

2113

Links to ovarian cancer gene database

2113

Links to endometrial cancer gene database

2113

Links to iHOP

2113

Sequence Information

Nucleotide Sequence

>2113 : length: 5730
AGCCCTCAAGAATGCGTGGAGAATCAGACGGACTTTCCCGAAACGGTGGAGGCGGCCTGT
GCACCCAGCCTGCACACCCGCTCCCGGCCCTTCCCGCCCCTGCCTGGGCTCCGAGGCCCG
GGGCTCCACGCACTGCTCCTCCGCGGTCGCGGCCCGGCCCCGCGCTCGCCAGCCCTTCCT
TTCGCTTTGGGCCGCGGGCGGAGATTGGCCGCGGTGCTCGGCCCCGCCCCCGGCTCCCCG
CCCTGCCCCGACGCCCCGCCCCTCGCTCCCCCAAGCGGACATCGCCCGGCCCAGGGCGCG
CGGACCCAGCGGCCGAGACGCGGCGCCGCGAGAAACGCCCTAAAGAGGAGGGGAGAGCGC
GGGAGGGCGAGAGGGAGGGAGAGCGGCCGGGAGATCGAGAGCGAACGAGGCAGCCGCCGG
CGGAGAGGAGGGAGCGGGCGAGGGCCGGGCAGGAGGAGCGGGCGCGGCGCGGGCGAGGCT
GGGACCCGAGCGCGCTCACTTCGCCGCAAAGTGCCAACTTCCCCTGGAGTGCCGGGCGCG
CACCGTCCGGGCGCGGGGGAAAGAAAGGCAGCGGGAATTTGAGATTTTTGGGAAGAAAGT
CGGATTTCCCCCGTCCCCTTCCCCCTGTTACTAATCCTCATTAAAAAGAAAAACAACAGT
AACTGCAAACTTGCTACCATCCCGTACGTCCCCCACTCCTGGCACCATGAAGGCGGCCGT
CGATCTCAAGCCGACTCTCACCATCATCAAGACGGAAAAAGTCGATCTGGAGCTTTTCCC
CTCCCCGGGTCTGAACTCCGGCGCTGCCGAATTACAACTGCTTTCATTTGTTTTTCCTGC
TTCCCTACCATGTAATGGTCAAGGGCTCATTGGAACCATGTGTGAGCCTGATATGGAATG
TGCAGATGTCCCACTATTAACTCCAAGCAGCAAAGAAATGATGTCTCAAGCATTAAAAGC
TACTTTCAGTGGTTTCACTAAAGAACAGCAACGACTGGGGATCCCAAAAGACCCCCGGCA
GTGGACAGAAACCCATGTTCGGGACTGGGTGATGTGGGCTGTGAATGAATTCAGCCTGAA
AGGTGTAGACTTCCAGAAGTTCTGTATGAATGGAGCAGCCCTCTGCGCCCTGGGTAAAGA
CTGCTTTCTCGAGCTGGCCCCAGACTTTGTTGGGGACATCTTATGGGAACATCTAGAGAT
CCTGCAGAAAGAGGATGTGAAACCATATCAAGTTAATGGAGTCAACCCAGCCTATCCAGA
ATCCCGCTATACCTCGGATTACTTCATTAGCTATGGTATTGAGCATGCCCAGTGTGTTCC
ACCATCGGAGTTCTCAGAGCCCAGCTTCATCACAGAGTCCTATCAGACGCTCCATCCCAT
CAGCTCGGAAGAGCTCCTCTCCCTCAAGTATGAGAATGACTACCCCTCGGTCATTCTCCG
AGACCCTCTCCAGACAGACACCTTGCAGAATGACTACTTTGCTATCAAACAAGAAGTCGT
CACCCCAGACAACATGTGCATGGGGAGGACCAGTCGTGGTAAACTCGGGGGCCAGGACTC
TTTTGAAAGCATAGAGAGCTACGATAGTTGTGATCGCCTCACCCAGTCCTGGAGCAGCCA
GTCATCTTTCAACAGCCTGCAGCGTGTTCCCTCCTATGACAGCTTCGACTCAGAGGACTA
TCCGGCTGCCCTGCCCAACCACAAGCCCAAGGGCACCTTCAAGGACTATGTGCGGGACCG
TGCTGACCTCAATAAGGACAAGCCTGTCATTCCTGCTGCTGCCCTAGCTGGCTACACAGG
CAGTGGACCAATCCAGCTATGGCAGTTTCTTCTGGAATTACTCACTGATAAATCCTGTCA
GTCTTTTATCAGCTGGACAGGAGATGGCTGGGAATTCAAACTTTCTGACCCAGATGAGGT
GGCCAGGAGATGGGGAAAGAGGAAAAACAAACCTAAGATGAATTATGAGAAACTGAGCCG
TGGCCTACGCTACTATTACGACAAAAACATCATCCACAAGACAGCGGGGAAACGCTACGT
GTACCGCTTTGTGTGTGACCTGCAGAGCCTGCTGGGGTACACCCCTGAGGAGCTGCACGC
CATGCTGGACGTCAAGCCAGATGCCGACGAGTGATGGCACTGAAGGGGCTGGGGAAACCC
TGCTGAGACCTTCCAAGGACAGCCGTGTTGGTTGGACTCTGAATTTTGAATTGTTATTCT
ATTTTTTATTTTCCAGAACTCATTTTTTACCTTCAGGGGTGGGAGCTAAGTCAGTTGCAG
CTGTAATCAATTGTGCGCAGTTGGGAAAGGAAAGCCAGGACTTGTGGGGTGGGTGGGACC
AGAAATTCTTGAGCAAATTTTCAGGAGAGGGAGAAGGGCCTTCTCAGAAGCTTGAAGGCT
CTGGCTTAACAGAGAAAGAGACTAATGTGTCCAATCATTTTTAAAAATCATCCATGAAAA
AGTGTCTTGAGTTGTGGACCCATTAGCAAGTGACATTGTCACATCAGAACTCATGAAACT
GATGTAAGGCAATTAATTTGCTTCTGTTTTTAGGTCTGGGAGGGCAAAAAAGAGGTGGGT
GGGATGAAACATGTTTTGGGGGGGGATGCACTGAAAATCTGAGAACTATTTACCTATCAC
TCTAGTTTTGAAGCAAAGATGGACTTCAGTGGGGAGGGGCCAAAACCGTTGTTGTGTTAA
AATTTATTTTATTAAATTTTGTGCCAGTATTTTTTTTCTTAAAAATCGTCTTAAGCTCTA
AGGTGGTCTCAGTATTGCAATATCATGTAAGTTTGTTTTTATTTGCCGGCTGAGGATTCT
GTCACAATGAAAGAAAACTGTTTATATAGACCCCATTGGAAAAGCAAAACGCTCTCACTG
AGATCAGGGATCCCAAATTCATGGGACTTATATAAGAAGGACAATTAATGCTGATTTGGG
TACAGGGGAATTATGTGTGTGAATGTCATCTACAATTAAAAAAAATTAGCACATCCCTTT
ACTTACTTGTTATCAGTGGATTCTCGGGGTTTGGACTTAATGTTGAGCTAAGAAGCATTA
AGTCTTTGAACTGAATGTATTTTGCATCCCTGGTTTTGGACGACAGTAAACGTAGGAGCA
CTGTTGAAGTCCTGGAAGGGAGATCGAAGGAGGAAGATTGACTTGGTTCTTTCTTAGTCC
TATATCTGTAGCATAGATGACTTGGAATAAAAGCTGTATGCATGGGCATTACCCCTCAGG
TCCTAAGAAATAAGTCCTGAATGCATGTCGTTCCAAACTAACACTCTGTAATTTTTCTTT
TATGTCTTATTTTCCAAGAGTCCTCCATTTTTTGCACCCCCTCACCGCCAACTCTGTTAT
TCAGTAGAGAGAAGTGTACGGCTTTCTGATTGGTGAGTGAAAAAGTAACTTGAGACACGA
CCTAAGTTGAAGAGTTTAGACTTGCTGAGTTTTAGAAGTGATGGAAATTAAGAGAGCATT
TCAATAAAATGTGACTTGGCTGTCTTTGGAAGAGAAGTGCAAGGCTTTCCTTTGAAGAAT
TTAAATTAGTCCGGTAGGATGTCAGGTGAGACTGTGTATGCAAAATGAATGGCACAGGTG
ATGCCAGGGCCTCTTGCTTGGGTCTGATGTCTTGGCACAGGGTAAGTGAAGGTTAATTCC
AGAAGAGAGGAATGACTTGAAGGCAAAGGAAACTAAGGAAGGAGGTTCAGTGAGGAAAAT
AAGGTTGTCCATGAGATTTGAATAGATTTTTAGTTCCCCCAAGGTTTAAATACAAACATA
GTCAAGCAAGGTAGTCATCTTTCTGCTGGTTGTGAGGGGGAATCTGAAAATGGAGTTTTA
GAGGAAAAGTCAACATCTAACTAGTGAGGAAAAGTGCCTAATACAATTAGAATCTCCCTC
ACTCTATAGTTGCCCAGTTGAAAGGATAAGGAGGAGGGGTGGCTTTTATGGACTTCCATG
AGAGAAGGAAAGAAATATTTCAGGTAAGCTTCTCAGGGCTGGCCCTTTTTGGGATTTGGA
TGAGAAATTGGAAGTACTAACTACTTTCTAGCATATCTTTAAGAAAATTGATTGTTATTT
ACTCCCAGATCCTCTTGCAGACCCAGAATTATCAGGAACATAGCTCTGTGATTCATGAGT
GTCCCCATACTGATGAATTGGAGCATCCATATGGAAAGCAAAGGCAGAATTATCCCAGCT
GTATTATTTTGATCTTTTGGATGCAGGTGCCTTAATGAAGCTCTCAAAATATTTTAGGAG
CTGCTCAGGGAGTGTTGGGTGGAACTGTTTGGACTACATTGTTTTCTCTTAGATTATGTG
ATTTTTGTTGGGCACTGGCAAAAGGTGTGTGTGTGAATGTGTGCATGTGTGTGAATGTTG
TGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTTTGCAGACATGCAAAAC
TGCAGCTGAAATAATACCTTAGATTTCTAGGTAAGTCTTTCCACATTTCAATAATGGGTA
AGAGTAGAACCAGGGCCGGGTATCAATTATTGCTTGCTGTTTGCAACCAGGCATAAAATC
ACTTTCTCAAATCATCCACCGTTCCTATTAAATTTATGCCGGAAACTCTCCTTCTGTGAG
TATAACTCCTGCAGTTCCTATAGCAGATAAGATATAAGAAAGTGCCTCCTAGTGCTCCTC
CGCCCGCTTGTTTGCTAAAATTCCCTTTCTCTCTAAGTCCACCATTTTCAAGATTTGTAG
ATAGTGTATTAGTTAAGACAGCTTTGTCGATCTGGCCAGATGTTTTTTCTCCTTTGTCCA
AAGGCCAGAGACCATCCCAGGAAGAGTGGTGGGTGGTTTATACACTGGAAATGTTGCGTT
TATGCTTTTTAAAAACACACGTTAACTTCAGAGGAAGGATGGGCAAATCTGGTCTAGCTG
GGTGAAACCCTTATTTTCCCAGAGATGCCTTAACCTTTGTTGGTTTTGGCTTTAGGGTTC
AGAGTCACTTTTGTTCCCTTCTCCATTCTGGAGAGGGACTTCCCCTACATAGAGCCCTGA
TTTTTGTGGCTGTGGGGATTGGAGGTAGCATTCAAAGATCAGATGTGCTTTTCCTCACTT
TGGAGATGAACACTCTGGGTTTTACAGCATTAACCTGCCTAACCTTCATGGTGAGAAATA
CACCATCTCTCTTCTAGTCATGCTGTGCATGCCGCTTACTCTGTTGGGGTCTATATAAAT
TTGTTGAACTCTTACCTACATTCCAAAGAAGTTTCAAGGAACCATAAATATATGTATACA
TATACATATATAAAATATATATATTAAAATAAAATTATCAGGAATACTGCCTCAGTTATT
GAACTTTTTTTTTTAAGAATACTTTTTTTTTAAGCTGAGAAGTATAGGGATGAAAAAGAT
GTTATATTGTGTTTGACTATTTTCCAACTTGTATTTTCATATAATTTATATTTTTTAAAA
GCTGAAAATTTAGAAGCAAGATGAAAAAAAGGAAAAGCAGGTGCTTTTTAAAAATCAGAA
CTGAGGTAGCTTAGAGATGTAGCGATGTAAGTGTCGATGTTTTTTTAAAAAAAAATGCAA
AAAAATTCTTATGGCGGAGTTTTTTGTTTGTTTATTTTAGTAGCTGATGCTGGCACATCA
TTTTGCTGGAGAGTTTTTTATATACTGTAGCCTGATTTCATATTGTATTTTAAACTGTGT
GAAATTAAAAACAAAGAATTTCATTCATAA

Protein Sequence

>2113 : length: 519
MSYFVDSAGSSPVPYSAPRPAVVRQGPSNTYEDPRMNCGFQSNYHQQRPCYPFWDEMATQ
EVPTGLEHCVSGLNSGAAELQLLSFVFPASLPCNGQGLIGTMCEPDMECADVPLLTPSSK
EMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNG
AALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISY
GIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQND
YFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPS
YDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLL
ELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNII
HKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE