ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

208

Name

AKT2

Synonym

HIHGHH|PKBB|PKBBETA|PRKBB|RAC-BETA;v-akt murine thymoma viral oncogene homolog 2;AKT2;v-akt murine thymoma viral oncogene homolog 2

Definition

PKB beta|RAC-PK-beta|RAC-beta serine/threonine-protein kinase|murine thymoma viral (v-akt) homolog-2|protein kinase Akt-2|protein kinase B beta|rac protein kinase beta

Position

19q13.1-q13.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Fc gamma R-mediated phagocytosis;KEGG PATHWAY;hsa04666

Pathway

Class I PI3K signaling events mediated by Akt;PID Curated;200169

Pathway

Insulin/IGF pathway-protein kinase B signaling cascade;PANTHER;P00033

Pathway

B cell receptor signaling pathway;KEGG PATHWAY;hsa04662

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Pathway

Signaling by Insulin receptor;Reactome;REACT:498

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

Endometrial cancer;KEGG PATHWAY;hsa05213

Pathway

Insulin Pathway;PID Curated;200012

Pathway

PDGF signaling pathway;PANTHER;P00047

Pathway

E-cadherin signaling in keratinocytes;PID Curated;200125

Pathway

Inhibition of TSC complex formation by PKB;PID Reactome;500906

Pathway

Toxoplasmosis;KEGG PATHWAY;hsa05145

Pathway

FGF signaling pathway;PANTHER;P00021

Pathway

Pancreatic cancer;KEGG PATHWAY;hsa05212

Pathway

VEGF signaling pathway;KEGG PATHWAY;hsa04370

Pathway

Inhibition of HSL;PID Reactome;501025

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032

Pathway

T cell receptor signaling pathway;KEGG PATHWAY;hsa04660

Pathway

Small cell lung cancer;KEGG PATHWAY;hsa05222

Pathway

Endothelin signaling pathway;PANTHER;P00019

Pathway

Activation of PKB;PID Reactome;501026

Pathway

T cell activation;PANTHER;P00053

Pathway

Carbohydrate digestion and absorption;KEGG PATHWAY;hsa04973

Pathway

Hepatitis C;KEGG PATHWAY;hsa05160

Pathway

FAS signaling pathway;PANTHER;P00020

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Pathway

EGF receptor signaling pathway;PANTHER;P00018

Pathway

Adipocytokine signaling pathway;KEGG PATHWAY;hsa04920

Pathway

Insulin signaling pathway;KEGG PATHWAY;hsa04910

Pathway

p53 pathway;PANTHER;P00059

Pathway

Hypoxia response via HIF activation;PANTHER;P00030

Pathway

Regulation of beta-cell development;Reactome;REACT:13698

Pathway

Melanoma;KEGG PATHWAY;hsa05218

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

Progesterone-mediated oocyte maturation;KEGG PATHWAY;hsa04914

Pathway

Fc epsilon RI signaling pathway;KEGG PATHWAY;hsa04664

Pathway

p53 pathway by glucose deprivation;PANTHER;P04397

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

PDE3B signalling;PID Reactome;500958

Pathway

Non-small cell lung cancer;KEGG PATHWAY;hsa05223

Pathway

Inhibition of HSL;Reactome;REACT:1123

Pathway

mTOR signaling pathway;KEGG PATHWAY;hsa04150

Pathway

Huntington disease;PANTHER;P00029

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Renal cell carcinoma;KEGG PATHWAY;hsa05211

Pathway

Chagas disease;KEGG PATHWAY;hsa05142

Pathway

Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630

Pathway

Glioma;KEGG PATHWAY;hsa05214

Pathway

PI3 kinase pathway;PANTHER;P00048

Pathway

Hemostasis;Reactome;REACT:604

Pathway

Toll-like receptor signaling pathway;KEGG PATHWAY;hsa04620

Pathway

Apoptosis;KEGG PATHWAY;hsa04210

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

Tight junction;KEGG PATHWAY;hsa04530

Pathway

Apoptosis signaling pathway;PANTHER;P00006

Pathway

Insulin-mediated glucose transport;PID Curated;200168

Pathway

p53 pathway feedback loops 2;PANTHER;P04398

Pathway

Interleukin signaling pathway;PANTHER;P00036

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

Acute myeloid leukemia;KEGG PATHWAY;hsa05221

Disease

Hyperglycemia;FunDO

Disease

Cancers;KEGG DISEASE

Disease

Diabetes mellitus;FunDO

Disease

Genetic disorders;KEGG DISEASE

Disease

blood pressure, arterial cholesterol insulin resistance metabolic syndrome;GAD

Disease

Congenital abnormality;FunDO

Disease

Ovarian cancer;KEGG DISEASE;H00027

Disease

CARDIOVASCULAR;GAD

Disease

Obesity;FunDO

Disease

Familial partial lipodystrophy;KEGG DISEASE;H00420

Disease

Other genetic disorders;KEGG DISEASE

Disease

Cancer;FunDO

Disease

Diabetes mellitus, type II;OMIM

Disease

Cancers of the breast and female genital organs;KEGG DISEASE

Disease

Metabolism disease;FunDO

External Links

Links to cell senescence gene database

208

Links to epithelial mesenchymal transition gene database

208

Links to ovarian cancer gene database

208

Links to endometrial cancer gene database

208

Links to iHOP

208

Sequence Information

Nucleotide Sequence

>208 : length: 5317
TGGGAGGGGGCGGTAAGCGGGGGCTGGGGGGAGGGGGCGGGGGGGGCCGCGCCGTGCTAG
CCGTTGGGCCTGCCTCGGAGGAGGCGTCGCCGCCGCCGCTGCCGCTGCCGGCGCCGTTGC
CGCTGCCGGGAAACACAAGGAAAGGGAACCAGCGCAGCGTGGCGATGGGCGGGGGTAGAG
CCCCGCCGGAGAGGCTGGGCGGCTGCCGGTGACAGACTGTGCCCTGTCCACGGTGCCTCC
TGCATGTCCTGCTGCCCTGAGCTGTCCCGAGCTAGGTGACAGCGTACCACGCTGCCACCA
TGAATGAGGTGTCTGTCATCAAAGAAGGCTGGCTCCACAAGCGTGGTGAATACATCAAGA
CCTGGAGGCCACGGTACTTCCTGCTGAAGAGCGACGGCTCCTTCATTGGGTACAAGGAGA
GGCCCGAGGCCCCTGATCAGACTCTACCCCCCTTAAACAACTTCTCCGTAGCAGAATGCC
AGCTGATGAAGACCGAGAGGCCGCGACCCAACACCTTTGTCATACGCTGCCTGCAGTGGA
CCACAGTCATCGAGAGGACCTTCCACGTGGATTCTCCAGACGAGAGGGAGGAGTGGATGC
GGGCCATCCAGATGGTCGCCAACAGCCTCAAGCAGCGGGCCCCAGGCGAGGACCCCATGG
ACTACAAGTGTGGCTCCCCCAGTGACTCCTCCACGACTGAGGAGATGGAAGTGGCGGTCA
GCAAGGCACGGGCTAAAGTGACCATGAATGACTTCGACTATCTCAAACTCCTTGGCAAGG
GAACCTTTGGCAAAGTCATCCTGGTGCGGGAGAAGGCCACTGGCCGCTACTACGCCATGA
AGATCCTGCGGAAGGAAGTCATCATTGCCAAGGATGAAGTCGCTCACACAGTCACCGAGA
GCCGGGTCCTCCAGAACACCAGGCACCCGTTCCTCACTGCGCTGAAGTATGCCTTCCAGA
CCCACGACCGCCTGTGCTTTGTGATGGAGTATGCCAACGGGGGTGAGCTGTTCTTCCACC
TGTCCCGGGAGCGTGTCTTCACAGAGGAGCGGGCCCGGTTTTATGGTGCAGAGATTGTCT
CGGCTCTTGAGTACTTGCACTCGCGGGACGTGGTATACCGCGACATCAAGCTGGAAAACC
TCATGCTGGACAAAGATGGCCACATCAAGATCACTGACTTTGGCCTCTGCAAAGAGGGCA
TCAGTGACGGGGCCACCATGAAAACCTTCTGTGGGACCCCGGAGTACCTGGCGCCTGAGG
TGCTGGAGGACAATGACTATGGCCGGGCCGTGGACTGGTGGGGGCTGGGTGTGGTCATGT
ACGAGATGATGTGCGGCCGCCTGCCCTTCTACAACCAGGACCACGAGCGCCTCTTCGAGC
TCATCCTCATGGAAGAGATCCGCTTCCCGCGCACGCTCAGCCCCGAGGCCAAGTCCCTGC
TTGCTGGGCTGCTTAAGAAGGACCCCAAGCAGAGGCTTGGTGGGGGGCCCAGCGATGCCA
AGGAGGTCATGGAGCACAGGTTCTTCCTCAGCATCAACTGGCAGGACGTGGTCCAGAAGA
AGCTCCTGCCACCCTTCAAACCTCAGGTCACGTCCGAGGTCGACACAAGGTACTTCGATG
ATGAATTTACCGCCCAGTCCATCACAATCACACCCCCTGACCGCTATGACAGCCTGGGCT
TACTGGAGCTGGACCAGCGGACCCACTTCCCCCAGTTCTCCTACTCGGCCAGCATCCGCG
AGTGAGCAGTCTGCCCACGCAGAGGACGCACGCTCGCTGCCATCACCGCTGGGTGGTTTT
TTCCCCCTAACTTTTTACTTAGCCTTTTTGGTTTGTGTCCCCACCCCCACCTCCTCACCC
CCTTTCCAGTTCTTCTTCAGGCCCCTCCCAGACGCACCCCAGCGGCCCCTGCAGCCCCTG
CCTCCAGCCTCCAGCCTCACCTTTGTGCCCAGACTCGCATTTGGAAGACTCCACCTCCCG
CCCAGGCCTGGGCTGTTGGGCGGTTGGAGATTCAGGTTTTAATCCACACAAGCCCCAGTG
AGGGGTGAAGCATGGCGCCTGGGGCCTGCCTGAGTTTCTGGCCTGGGTGTCGTGCTGGTG
TCTGCCTCCGCGCTGCTGCATCTGGACGAAGGCTGCCTTCTGGTGGGACGCGACACCCGG
CAGACAGTGGTGCTGCCTTCCAGGCCCCGTGGCCTAGGCTCGGAGTGGCCAGGCACGGGG
CGGTCCAATCCCCCACCCGCTGTCCCCCTATGGGGGCAGAAAAGCAATAATGTCCAGGGG
CAGGCAGGGGCCCTTGGGAGCTGCAGGGCTGGGGGTTAGGGCTGCTCCCTGGTGAATGGA
GTCAGATCCTAGGATCTGTACCATGGGGAACCAGGAGTGGCCGGGCTGGGTGCCGCCTCC
TGGTCCGGCCTCCTCCCCACCAAACTGTCCTCACCCTATGGATGAGGCAGGAGGAACATT
TGGGGCCAAACCTGCCTGCCTCCCAGCCCCGTGCCTTACTAGGGCTTCCTTCCAGCTGGC
CTTACCTCCCGCTGGACCCTGGGCCTGGCCTGGCCCCACTGGGGGCTATGGGCTGGGCTC
ACCCTCTCCTCTGCGGGGGTGGAGGGCCACCAGCCTTGGCTGTTACAATCTTACACCGGA
CAGTATTGGGCCCCATGGACTTGGTCAGGGAGGGGTGGGGGTGGGCATCTCTGGTACCTA
TTGGGGTGGGGGGCCTCTGAAAAGGGAGGCTCCTAGGCCCCCCTCACCCCTCCCTCTCCC
CAGGGCCCCACGTTCTGCAGCCTTAAGGTTGAACATGAGTGCACGTCCATGTCAGTGCTG
TGGGACTCCTGTGCGTGCCTCGGACTGCGTGTGTCGGCGGGACGCAGGCACACGTGGGTG
TGTGTGCATGTGTGTTTGTGTGAGGGCAGCGTGTCCTCCAGTGTGCATGGTGTGTGGGCT
TGGGCCCCATCCCTGGCCCGAGCATTTCATCCTGTGGGGGAGGGGTGCTGACCTAGTGGG
AGGAGCCCCACTGTGATCCATGAGCTGCCCTGCCCACGCCTCCCCTCCCTGTAGCAACAC
CTCTGGGTGTTTGGAGTTTAGCTTTTGTGGGTTTGCTCTCCCTATCCCATCTCCTGTACT
ACACAGTTCATGGCAGGGTGGGGAGGGGTGGGGTTGGTTCGGGTGGGTGAGGGTCTTTTT
CCTCTGTGTGCGATGTTGTTATCTGACAGTTCTCCGTCCCTACTGGCCTTTCTCCTCGTC
TTCATATTTGTACGGTACAAGCAATAAAGACACTCATTTCAGACCAGGGCCCAGCCTGCA
CTCACGCCAGCCCAACCACTCTGGGCTTTGCCTTGGTGATGGAGTCAGACCCCTGGGCCC
CAGCTCCTCCTGTACTAGCCGTTCCCTTCAGCAAGGAGGGCACTGAGCTCAGGGTGAGGG
CAGCTGGGGTGTGTGCAGGAGCTCAGGCTGGAGAGGGTGGGTGGAGCTGGTGCTGTGGGG
CTGAGGGGTATGGGAAGGCTCCCCGCATGTGGGGGTGGGGTGGACAGAGACCACTCCAGG
CCCTCAGTGCTGCTTAGGCTAAGAGAGGTGGGGTGGAGGGACAGGGCTGGAAGATCTGGG
TAGCCCAGAATGAGGAGGGTGCCTGTGCTGTCACTGAATGAGAGGGAGTGGTTCATTCCA
CCCGGCTGCCGAGCCTCAGAGGGGGGCATTCCTATCCTGCCCCACCTCCCTGTTTATGCT
GCCACCTGGAAGCCTTGAGGCCCCCAAATTCCAGTACAGACCCAGTGGTGTGTTCATGGT
GGCGTGGTTGCTGTCACCTGGGAGCTCCTGAGCGTTTGGTTAGAACCCTGTTCAGCTTGG
GGTCAGCCCTCCCCTAGTCACTGCCCTTTAGCCTGGATGTGTCTGGGCCCCTGCACTTCC
CGTGCTTGAGTCACGTGGCTGCATGGCCGGGCGCTGGCCGGATGGAACACCTCCCCCAGC
AAGGGACCAGGGACCAGAGCCCTGGCCTGCCCTGCTGAGCCCTGCTGTGCAGAGGGCCTG
GCACAGATGAATTTGAGATTTTGCCGCAAGGTGTTAGCACTTCACACCCATTGAGTCTTT
GAGATTTTAAGTGAATGTAAGCAGAAAAAGTCAGATCCAATTTACAGAAATCAGAGTTAG
CTACAGCTAGGACTCGTTTGGTTGGGGTTTTTTAGTTTGTCTTTCTAAAGTCATGTGGAC
CTTAATTTAATTACAAAAGTCTACCCTGGTGGTCATAAAATAGGCAGGCCTATGAAGAAA
GGCCTTTTACTCTTCCATCTCGTCCCAGCCCCGAGTTGACCCACGTTGCTGCTCCTCACA
CCATGGTGATGCAGGTCTCGTAGTGTGGGCACAGGCCTGGCTACCTCATCTTTTTAGTGC
CTCTCTCCTCTTCCACAGGATGGGGTCCCACAGCTGCAGCAGCTGGCCCCGTAGTTGAGC
ATGTGTGGTTATCCTGTAGAGCTTTTCCCAAGAAGGGTGTTTGAACTTAGAGTCTTAATA
AAATCTTACCAAATAAATTTTGAGTAGAATAATCGTCTTTTGCAATGTACATTTTAAAAA
TTTCACACATTCTTTTTTGTATATAAAGAACAGTGACTGGGCACAGTGGCTCATGCCTGT
AATCCCAGCAATTTGGGAGGCCGAGGCGGGCGGGTCTCTTGAGGCCAGGGGTTCGAGACC
AGCCTGGGCATCATAGGGAGACCTTCATCTCTACAAAAAATACAAAAATTAGCTGGGCAT
GGTGGTGCATGCCTGCAATCCCAGCTAACTTGGAAGGCTGAGGTGAGGTGGGAAGATCAC
TTGAGCCCAGGAGTTTGAGGCTGCAGTGAGCTATGATTGCGGCACTGCACTGCAGCCTGG
GACAATGAGACTGTGTCTCTAAAAATAAAAAAAAAAAAAACATGATACATGCTATTAAAA
AAGACAGCAAAGCAGGAGTATAAGAAAGGAAATTCACCCGAGGTCGCAGGGCCTTGAGTA
CTCATTTTGGTGCTGATTACCTCTCTGCAAATGGACACGGCATCATAAATTGGTAGTTTC
CTGCTCTTTTTGTGTAATCTTTTCCAGTTAATGTGAAGCCTCTGGGGGCTGCCCTCGTGC
ACTGATGGTTGTGTGGAGTCGGGGGCGGCAGTGCGATTCCCTTTTAGCTGCTGCATGGGG
GGAACTCAGGCTTTCCAGCTGCTTCCTGGGGTTCCATGGGGTAGACCCCTCAACCGCTTC
AGCTGCCCCGTTAACAGGAATTGACTTGGTTTCGTTTGGTGCTACCAGCAGTCCTGTAAT
AAACTAGCTATCCATCTGTAAAAAAAAAAAAAAAAAA

Protein Sequence

>208 : length: 481
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRAPGEDPM
DYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIR
E