ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2078

Name

ERG

Synonym

erg-3|p55;v-ets avian erythroblastosis virus E26 oncogene homolog;ERG;v-ets avian erythroblastosis virus E26 oncogene homolog

Definition

TMPRSS2/ERG fusion|ets-related|transcriptional regulator ERG|transcriptional regulator ERG (transforming protein ERG)|v-ets avian erythroblastosis virus E26 oncogene related|v-ets erythroblastosis virus E26 oncogene homolog|v-ets erythroblastosis virus E2

Position

21q22.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

PDGF signaling pathway;PANTHER;P00047

Disease

Ewings sarcoma;FunDO

Disease

Prostate cancer;FunDO

Disease

Alzheimer's disease;FunDO

Disease

Cancers of soft tissues and bone;KEGG DISEASE

Disease

Leukemia;FunDO

Disease

Cancers;KEGG DISEASE

Disease

Down syndrome;FunDO

Disease

Ewing's sarcoma;KEGG DISEASE;H00035

External Links

Links to cell senescence gene database

2078

Links to epithelial mesenchymal transition gene database

2078

Links to ovarian cancer gene database

2078

Links to endometrial cancer gene database

2078

Links to iHOP

2078

Sequence Information

Nucleotide Sequence

>2078 : length: 5139
GCTGAGCCCGTCGGCGCCGAGGGAGTTAGTGCGACCCGGCTCGGCGCGCACGGCCAAGGC
ACGCGCGCTGGCACACGCGGGCGCGGACACGCGCGGACACACACGTGCGGGACACGCCCT
CCCCCGACGGCGGCGCTAACCTCTCGGTTATTCCAGGATCTTTGGAGACCCGAGGAAAGC
CGTGTTGACCAAAAGCAAGACAAATGACTCACAGAGAAAAAAGATGGCAGAACCAAGGGC
AACTAAAGCCGTCAGGTTCTGAACAGCTGGTAGATGGGCTGGCTTACTGAAGGACATGAT
TCAGACTGTCCCGGACCCAGCAGCTCATATCAAGGAAGCCTTATCAGTTGTGAGTGAGGA
CCAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATGACCGC
GTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTCAGCAGGA
TTGGCTGTCTCAACCCCCAGCCAGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGT
GAATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGG
CAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACATGCCACC
CCCAAACATGACCACGAACGAGCGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAG
TACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGT
CAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCAAGGACGA
CTTCCAGAGGCTCACCCCCAGCTACAACGCCGACATCCTTCTCTCACATCTCCACTACCT
CAGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAAAACTC
TCCACGGTTAATGCATGCTAGAAACACAGGGGGTGCAGCTTTTATTTTCCCAAATACTTC
AGTATATCCTGAAGCTACGCAAAGAATTACAACTAGGCCAGATTTACCATATGAGCCCCC
CAGGAGATCAGCCTGGACCGGTCACGGCCACCCCACGCCCCAGTCGAAAGCTGCTCAACC
ATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGAT
TCTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCA
GTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCAC
CAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAA
GAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAA
GAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGAT
CGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCT
CCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCC
TCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTC
ACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAGCCATATGCCTTCTCATCT
GGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCATTCACCAGCCC
ATCGCCACAAACTCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAG
CTTTACTGGGGCTGGGGAAGGAAGCCGGGGAAGAGATCCAAAGACTCTTGGGAGGGAGTT
ACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGAATATGGACATATC
ATCTGTGGACTGACCTTGTAAAAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAA
GTGCCAAAGAAAGTGGTCTTAAGAAATGTATAAACTTTAGAGTAGAGTTTGGAATCCCAC
TAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACACAGTTTTGACCTAACATACC
GTTTATAATGCCATTTTAAGGAAAACTACCTGTATTTAAAAATAGAAACATATCAAAAAC
AAGAGAAAAGACACGAGAGAGACTGTGGCCCATCAACAGACGTTGATATGCAACTGCATG
GCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTGATGGACAGCTGTCAGCTTTC
TCAAACTGTGAAGATGACCCAAAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGAA
CTAAAAGGTGGGACTGAGGATGTGTATAGAGTGAGCGTGTGATTGTAGACAGAGGGGTGA
AGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAAGAAACTTCTCAAG
CAATGAAGACTGGACTCAGGACATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAG
GGTTCATGCAGTCAGTGTTATACCAAACCCAGTGTTAGGAGAAAGGACACAGCGTAATGG
AGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTTCTTTGTTTGTCAA
ATGAAAATTTTAACTGGAATTGTCTGATATTTAAGAGAAACATTCAGGACCTCATCATTA
TGTGGGGGCTTTGTTCTCCACAGGGTCAGGTAAGAGATGGCCTTCTTGGCTGCCACAATC
AGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTGAGTCGCGAACGCT
GTGCGTTTGTCAGAATGAAGTATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATT
ATATAACTTATGCATTTATACACTACGAGTTGATCTCGGCCAGCCAAAGACACACGACAA
AAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCTGTATGCTTAATGTTTACAAT
ATGAAGTTATTAGTTCTTAGAATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCAT
GGCAAATCAGATTTATACAGGAGTCTGCATTTGCACTTTTTTTAGTGACTAAAGTTGCTT
AATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATAATTTACTTTGTCCAGGAACT
TGTGCAAGGGAGAGCCAAGGAAATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCA
GGTCCTTCTTGCCTCCCCTCCTGTCTTTTATTTCTAGCCCCTTTTGGAACAGAAGGACCC
CGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAGGCCTATGAAGCTG
GGGTTGTCATTGAGAAATTCTAGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCT
ATGATTAAAATACATTTGTTGAACAGTGAACAAGCTACCACTCGTAAGGCAAACTGTATT
ATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTACAGAAACAAGGGA
TAACGTCTAGATTTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTT
AGTCCTGCTACATCAGAGTTACCTGGGCACTGTGGCTTGGGATTCACTAGCCCTGAGCCT
GATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCATAATCTAGAGTCAGTTTCCC
TGGGCATCTTTTCTTTGAATCACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCA
AAAGGTGAAAATACAAGGTGACCGTGCGAAGGCGCTAGCCGAAACATCTTAGCTGAATAG
GTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTTCACGTTGCAGTCC
TTTTGCTATGATTATGTGAAGTTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGC
TTTGAAGTCGGCAGGACACGATTACCAATGCTCCTGACACCCCGTGTCATTTGGATTAGA
CGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACAAAGTGCCCGTATC
TCCTTAGGGAAAATAAATAAATACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTG
TGCTAATGGAAAAGATCAGTCATTTTTATTTTGGAATGCAAAGTCAAGACACACCTACAT
TCTTCATAGAAATACACATTTACTTGGATAATCACTCAGTTCTCTCTTCAAGACTGTCTC
ATGAGCAAGATCATAAAAACAAGACATGATTATCATATTCAATTTTAACAGATGTTTTCC
ATTAGATCCCTCAACCCTCCACCCCCAGTCCAGGTTATTAGCAAGTCTTATGAGCAACTG
GGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAAATACATAATTCTTAAATTGT
TTCAAAATGGCATTAACTCTCTGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGT
CATATTCATAATTGCATGAACCTTTTCTCTCTGTTTGTCCCTGTCTCTTGGCTTGCCCTG
ATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGCAAGAGATTTGTCTTCTTTTC
TTGTCTTCAATTGGCTTTCGGGCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGAC
TGTGTTTTTGTTCCTAGTTTGATGCCCTTATGTCCCGGAGGGGTTCACAAAGTGCTTTGT
CAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTGCACAGATGTGGCA
CCTGCAACCCAGGAGCAGGAGCCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGAT
GGCTACAGCTCAGGAGCTGGGAAGGTGATGGGGCACAGGGAAAGCACAGATGTTCTGCAG
CGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTTTAAAAAGCTAGTT
TATTTAGCTTCTCATTAATTCATTCAAATAAAGTCGTGAGGTGACTAATTAGAGAATAAA
AATTACTTTGGACTACTCAAAAATACACCAAAAAAAAAA

Protein Sequence

>2078 : length: 486
MIQTVPDPAAHIKEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSPRVPQ
QDWLSQPPARVTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHM
PPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKEYGLPDVNILLFQNIDGKELCKMTK
DDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPN
TSVYPEATQRITTRPDLPYEPPRRSAWTGHGHPTPQSKAAQPSPSTVPKTEDQRPQLDPY
QILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGE
RKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPS
DLPYMGSYHAHPQKMNFVAPHPPALPVTSSSFFAAPNPYWNSPTGGIYPNTRLPTSHMPS
HLGTYY