ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

207

Name

AKT1

Synonym

AKT|CWS6|PKB|PKB-ALPHA|PRKBA|RAC|RAC-ALPHA;v-akt murine thymoma viral oncogene homolog 1;AKT1;v-akt murine thymoma viral oncogene homolog 1

Definition

AKT1m|PKB alpha|RAC-PK-alpha|RAC-alpha serine/threonine-protein kinase|protein kinase B alpha|proto-oncogene c-Akt|rac protein kinase alpha

Position

14q32.32

Gene Type

protein-coding

Pathways and Diseases

Pathway

Apoptosis;Reactome;REACT:578

Pathway

il-2 receptor beta chain in t cell activation;PID BioCarta;100129

Pathway

Fc gamma R-mediated phagocytosis;KEGG PATHWAY;hsa04666

Pathway

role of erbb2 in signal transduction and oncology;PID BioCarta;100147

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

Endometrial cancer;KEGG PATHWAY;hsa05213

Pathway

mtor signaling pathway;PID BioCarta;100101

Pathway

VEGFR1 specific signals;PID Curated;200151

Pathway

PDGFR-beta signaling pathway;PID Curated;200127

Pathway

Regulation of beta-cell development;Reactome;REACT:13698

Pathway

FGF signaling pathway;PANTHER;P00021

Pathway

inactivation of gsk3 by akt causes accumulation of b-catenin in alveolar macrophages;PID BioCarta;100152

Pathway

EGF receptor signaling pathway;PANTHER;P00018

Pathway

eNOS activation;PID Reactome;500849

Pathway

IFN-gamma pathway;PID Curated;200110

Pathway

inhibition of cellular proliferation by gleevec;PID BioCarta;100154

Pathway

Hedgehog signaling events mediated by Gli proteins;PID Curated;200147

Pathway

Signaling events mediated by PTP1B;PID Curated;200033

Pathway

Endothelins;PID Curated;200004

Pathway

Progesterone-mediated oocyte maturation;KEGG PATHWAY;hsa04914

Pathway

S1P3 pathway;PID Curated;200035

Pathway

Aurora A signaling;PID Curated;200166

Pathway

E-cadherin signaling in the nascent adherens junction;PID Curated;200105

Pathway

Huntington disease;PANTHER;P00029

Pathway

nfat and hypertrophy of the heart ;PID BioCarta;100098

Pathway

b cell survival pathway;PID BioCarta;100228

Pathway

Toll-like receptor signaling pathway;KEGG PATHWAY;hsa04620

Pathway

Hemostasis;Reactome;REACT:604

Pathway

regulation of bad phosphorylation;PID BioCarta;100233

Pathway

Apoptosis signaling pathway;PANTHER;P00006

Pathway

IL2 signaling events mediated by PI3K;PID Curated;200099

Pathway

p53 pathway feedback loops 2;PANTHER;P04398

Pathway

Coregulation of Androgen receptor activity;PID Curated;200038

Pathway

trka receptor signaling pathway;PID BioCarta;100011

Pathway

Class I PI3K signaling events mediated by Akt;PID Curated;200169

Pathway

Nephrin/Neph1 signaling in the kidney podocyte;PID Curated;200132

Pathway

Negative regulation of the PI3K/AKT network;PID Reactome;500642

Pathway

AKT-mediated inactivation of FOXO1A;PID Reactome;500523

Pathway

Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161

Pathway

Toxoplasmosis;KEGG PATHWAY;hsa05145

Pathway

BCR signaling pathway;PID Curated;200005

Pathway

human cytomegalovirus and map kinase pathways;PID BioCarta;100149

Pathway

p53 pathway;PID Curated;200175

Pathway

Regulation of nuclear SMAD2/3 signaling;PID Curated;200002

Pathway

Integrin cell surface interactions;Reactome;REACT:13552

Pathway

Activation of BAD and translocation to mitochondria;PID Reactome;500261

Pathway

CD40/CD40L signaling;PID Curated;200031

Pathway

CXCR3-mediated signaling events;PID Curated;200150

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Pathway

p53 pathway;PANTHER;P00059

Pathway

TCR signaling in naive CD4+ T cells;PID Curated;200022

Pathway

Thromboxane A2 receptor signaling;PID Curated;200069

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

Insulin/IGF pathway-protein kinase B signaling cascade;PANTHER;P00033

Pathway

Angiogenesis;PANTHER;P00005

Pathway

phospholipids as signalling intermediaries;PID BioCarta;100183

Pathway

IGF1 pathway;PID Curated;200084

Pathway

skeletal muscle hypertrophy is regulated via akt-mtor pathway;PID BioCarta;100137

Pathway

transcription factor creb and its extracellular signals;PID BioCarta;100198

Pathway

pten dependent cell cycle arrest and apoptosis;PID BioCarta;100058

Pathway

Melanoma;KEGG PATHWAY;hsa05218

Pathway

Glioma;KEGG PATHWAY;hsa05214

Pathway

AKT phosphorylates targets in the nucleus;PID Reactome;500641

Pathway

role of nicotinic acetylcholine receptors in the regulation of apoptosis;PID BioCarta;100255

Pathway

Interleukin signaling pathway;PANTHER;P00036

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

amb2 Integrin signaling;PID Curated;200108

Pathway

influence of ras and rho proteins on g1 to s transition;PID BioCarta;100054

Pathway

CTLA4 inhibitory signaling;PID Reactome;500487

Pathway

B cell receptor signaling pathway;KEGG PATHWAY;hsa04662

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Pathway

p53 pathway by glucose deprivation;PANTHER;P04397

Pathway

HIF-1-alpha transcription factor network;PID Curated;200172

Pathway

CXCR4-mediated signaling events;PID Curated;200083

Pathway

PI3K/AKT signalling;PID Reactome;500639

Pathway

telomeres telomerase cellular aging and immortality;PID BioCarta;100021

Pathway

E-cadherin signaling in keratinocytes;PID Curated;200125

Pathway

trefoil factors initiate mucosal healing;PID BioCarta;100018

Pathway

p75(NTR)-mediated signaling;PID Curated;200103

Pathway

Pancreatic cancer;KEGG PATHWAY;hsa05212

Pathway

Trk receptor signaling mediated by PI3K and PLC-gamma;PID Curated;200183

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

T cell receptor signaling pathway;KEGG PATHWAY;hsa04660

Pathway

Nongenotropic Androgen signaling;PID Curated;200145

Pathway

mTOR signaling pathway;PID Curated;200080

Pathway

corticosteroids and cardioprotection;PID BioCarta;100156

Pathway

tumor suppressor arf inhibits ribosomal biogenesis;PID BioCarta;100237

Pathway

FGF signaling pathway;PID Curated;200189

Pathway

Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031

Pathway

FAS signaling pathway;PANTHER;P00020

Pathway

AKT phosphorylates targets in the cytosol;PID Reactome;500640

Pathway

Insulin Pathway;PID Curated;200012

Pathway

CD28 dependent PI3K/Akt signaling;PID Reactome;500485

Pathway

mTOR signaling pathway;KEGG PATHWAY;hsa04150

Pathway

ras signaling pathway;PID BioCarta;100047

Pathway

Renal cell carcinoma;KEGG PATHWAY;hsa05211

Pathway

actions of nitric oxide in the heart;PID BioCarta;100094

Pathway

Fc epsilon RI signaling pathway;KEGG PATHWAY;hsa04664

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

Retinoic acid receptors-mediated signaling;PID Curated;200142

Pathway

FAS (CD95) signaling pathway;PID Curated;200067

Pathway

Ceramide signaling pathway;PID Curated;200100

Pathway

Metabolism of nitric oxide;Reactome;REACT:12508

Pathway

vegf hypoxia and angiogenesis;PID BioCarta;100006

Pathway

a6b1 and a6b4 Integrin signaling;PID Curated;200162

Pathway

Signaling events mediated by Stem cell factor receptor (c-Kit);PID Curated;200156

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

Insulin-mediated glucose transport;PID Curated;200168

Pathway

Glucocorticoid receptor regulatory network;PID Curated;200077

Pathway

Small cell lung cancer;KEGG PATHWAY;hsa05222

Pathway

il 4 signaling pathway;PID BioCarta;100127

Pathway

Fc-epsilon receptor I signaling in mast cells;PID Curated;200003

Pathway

ErbB1 downstream signaling;PID Curated;200113

Pathway

VEGFR3 signaling in lymphatic endothelium;PID Curated;200188

Pathway

ion channels and their functional role in vascular endothelium;PID BioCarta;100055

Pathway

akt signaling pathway;PID BioCarta;100245

Pathway

LPA receptor mediated events;PID Curated;200011

Pathway

VEGF signaling pathway;KEGG PATHWAY;hsa04370

Pathway

IL4-mediated signaling events;PID Curated;200018

Pathway

Regulation of Telomerase;PID Curated;200072

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032

Pathway

Endothelin signaling pathway;PANTHER;P00019

Pathway

T cell activation;PANTHER;P00053

Pathway

Reelin signaling pathway;PID Curated;200051

Pathway

Carbohydrate digestion and absorption;KEGG PATHWAY;hsa04973

Pathway

role of erk5 in neuronal survival pathway;PID BioCarta;100171

Pathway

Hepatitis C;KEGG PATHWAY;hsa05160

Pathway

PI3 kinase pathway;PANTHER;P00048

Pathway

IL6-mediated signaling events;PID Curated;200124

Pathway

Adipocytokine signaling pathway;KEGG PATHWAY;hsa04920

Pathway

ErbB2/ErbB3 signaling events;PID Curated;200119

Pathway

Insulin signaling pathway;KEGG PATHWAY;hsa04910

Pathway

Hypoxia response via HIF activation;PANTHER;P00030

Pathway

hypoxia and p53 in the cardiovascular system;PID BioCarta;100084

Pathway

VEGF signaling pathway;PANTHER;P00056

Pathway

phosphoinositides and their downstream targets;PID BioCarta;100059

Pathway

Plasma membrane estrogen receptor signaling;PID Curated;200029

Pathway

Signaling events mediated by the Hedgehog family;PID Curated;200144

Pathway

Non-small cell lung cancer;KEGG PATHWAY;hsa05223

Pathway

apoptotic signaling in response to dna damage;PID BioCarta;100204

Pathway

control of skeletal myogenesis by hdac and calcium/calmodulin-dependent kinase (camk);PID BioCarta;100148

Pathway

Chagas disease;KEGG PATHWAY;hsa05142

Pathway

Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630

Pathway

Angiopoietin receptor Tie2-mediated signaling;PID Curated;200066

Pathway

Integrins in angiogenesis;PID Curated;200109

Pathway

Apoptosis;KEGG PATHWAY;hsa04210

Pathway

the igf-1 receptor and longevity;PID BioCarta;100115

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

Tight junction;KEGG PATHWAY;hsa04530

Pathway

TCR signaling in naive CD8+ T cells;PID Curated;200062

Pathway

FoxO family signaling;PID Curated;200091

Pathway

FOXA2 and FOXA3 transcription factor networks;PID Curated;200073

Pathway

Ras Pathway;PANTHER;P04393

Pathway

regulation of eif-4e and p70s6 kinase;PID BioCarta;100178

Pathway

Acute myeloid leukemia;KEGG PATHWAY;hsa05221

Disease

Ovarian cancer, somatic;OMIM

Disease

Hyperglycemia;FunDO

Disease

Cancer;FunDO

Disease

Systemic scleroderma;FunDO

Disease

Huntington disease;FunDO

Disease

Colorectal cancer, somatic;OMIM

Disease

Vitiligo;FunDO

Disease

Polycystic ovary syndrome;FunDO

Disease

Systemic infection;FunDO

Disease

Schizophrenia;FunDO

Disease

PSYCH;GAD

Disease

Diabetes mellitus;FunDO

Disease

CHEMDEPENDENCY;GAD

Disease

Psychotic disorder;FunDO

Disease

Tropical spastic paraparesis;FunDO

Disease

Adenovirus infection;FunDO

Disease

Schizophrenia, susceptibility to;OMIM

Disease

Breast cancer, somatic;OMIM

Disease

Hypertension;FunDO

Disease

methamphetamine abuse;GAD

Disease

schizophrenia;GAD

Disease

Obesity;FunDO

Disease

Atherosclerosis;FunDO

External Links

Links to cell senescence gene database

207

Links to epithelial mesenchymal transition gene database

207

Links to ovarian cancer gene database

207

Links to endometrial cancer gene database

207

Links to iHOP

207

Sequence Information

Nucleotide Sequence

>207 : length: 3681
AAGAATATGTGCTTATGGTAAAGGCAGGCGGCAGGTACGGAGGCTGTGGGAAGTCGGGGT
CCCTCCGCCCCCACAGGCAGCCCTGTGCTGGCCTGGTGTATACGTTTCTGTGCAGACGTA
CACCACCCTGTGTGAGCACAGATGTATTTTTACACATGGCTCTGGACAGCTGTCTGACTC
TGTCAGCAGCAGGCCTTGGAGGGGCTCAGGCCCGTGTGGGGGTGGGGGGACATCCAGAGG
TCTTTGAGTCCAGCCCTCTGCCTCCAGGCCACGCCCACTCAGTGTCGTCAGAGCCCCCTG
TGCCTGAGGCGTGCGCGGCTCGGAGCCCTGCCCTCGGAGTCCTGCGGTGCCTTCCTCGAG
TCTGGCCTGCTTTCCATCCTGCTAAGTACTTGGGGCATTTCCCTCTTTGGGTAAGGTGTG
GTCTTCCCTGTCCTGGCATTAGACACAAGGCAGTGGGCCTTCCTGCCATTCTAAGTGTAG
CTTAAGACAATCAGTGCAAAGCAACCCTTTGTGGGTGTCCAGCCCTTGCCTCGGGAGGCC
AGAAAGGTGGCCTGGGGGGAGAGCGTCTAAGCTGGCTGTGGAAAGACCCATGTTGGGATC
CATTCCACAGAGGTCGTCAGGGGTCTCTGCCTGGCCTGGAGGTCCCAGAGAGGACCCTCC
TCCCCTCAGGAAGGCCCATCTGGAAGGGTAGCAGAGGACTGCTCACAGGAAGAGCATGCG
AAGTGCTCTTTCTGGGGATGCCTGTAGTTGGTGATGTGGGAACTGGGTTTTGAGGGATGC
CTAGGAGTTCATCCATCAGAGGGGAAATGAGGAAGCCATGCAGGATCAATGGATAAAGTG
TGCTCAGGTGAGGGTTGGCTGGTGGGCCGCTGCAGGGCGGGGGCCTGTCCAGTGCTCCCC
CACTTACTTGCTGCCTCCCGACTGCTGTAATTATGGGTCTGTAACCACCCTGGACTGGGT
GCTCCTCACTGACGGACTTGTCTGAACCTCTCTTTGTCTCCAGCGCCCAGCACTGGGCCT
GGCAAAACCTGAGACGCCCGGTACATGTTGGCCAAATGAATGAACCAGATTCAGACCGGC
AGGGGCGCTGTGGTTTAGGAGGGGCCTGGGGTTTCTCCCAGGAGGTTTTTGGGCTTGCGC
TGGAGGGCTCTGGACTCCCGTTTGCGCCAGTGGCCTGCATCCTGGTCCTGTCTTCCTCAT
GTTTGAATTTCTTTGCTTTCCTAGTCTGGGGAGCAGGGAGGAGCCCTGTGCCCTGTCCCA
GGATCCATGGGTAGGAACACCATGGACAGGGAGAGCAAACGGGGCCATCTGTCACCAGGG
GCTTAGGGAAGGCCGAGCCAGCCTGGGTCAAAGAAGTCAAAGGGGCTGCCTGGAGGAGGC
AGCCTGTCAGCTGGTGCATCAGAGGCTGTGGCCAGGCCAGCTGGGCTCGGGGAGCGCCAG
CCTGAGAGGAGCGCGTGAGCGTCGCGGGAGCCTCGGGCACCATGAGCGACGTGGCTATTG
TGAAGGAGGGTTGGCTGCACAAACGAGGGGAGTACATCAAGACCTGGCGGCCACGCTACT
TCCTCCTCAAGAATGATGGCACCTTCATTGGCTACAAGGAGCGGCCGCAGGATGTGGACC
AACGTGAGGCTCCCCTCAACAACTTCTCTGTGGCGCAGTGCCAGCTGATGAAGACGGAGC
GGCCCCGGCCCAACACCTTCATCATCCGCTGCCTGCAGTGGACCACTGTCATCGAACGCA
CCTTCCATGTGGAGACTCCTGAGGAGCGGGAGGAGTGGACAACCGCCATCCAGACTGTGG
CTGACGGCCTCAAGAAGCAGGAGGAGGAGGAGATGGACTTCCGGTCGGGCTCACCCAGTG
ACAACTCAGGGGCTGAAGAGATGGAGGTGTCCCTGGCCAAGCCCAAGCACCGCGTGACCA
TGAACGAGTTTGAGTACCTGAAGCTGCTGGGCAAGGGCACTTTCGGCAAGGTGATCCTGG
TGAAGGAGAAGGCCACAGGCCGCTACTACGCCATGAAGATCCTCAAGAAGGAAGTCATCG
TGGCCAAGGACGAGGTGGCCCACACACTCACCGAGAACCGCGTCCTGCAGAACTCCAGGC
ACCCCTTCCTCACAGCCCTGAAGTACTCTTTCCAGACCCACGACCGCCTCTGCTTTGTCA
TGGAGTACGCCAACGGGGGCGAGCTGTTCTTCCACCTGTCCCGGGAGCGTGTGTTCTCCG
AGGACCGGGCCCGCTTCTATGGCGCTGAGATTGTGTCAGCCCTGGACTACCTGCACTCGG
AGAAGAACGTGGTGTACCGGGACCTCAAGCTGGAGAACCTCATGCTGGACAAGGACGGGC
ACATTAAGATCACAGACTTCGGGCTGTGCAAGGAGGGGATCAAGGACGGTGCCACCATGA
AGACCTTTTGCGGCACACCTGAGTACCTGGCCCCCGAGGTGCTGGAGGACAATGACTACG
GCCGTGCAGTGGACTGGTGGGGGCTGGGCGTGGTCATGTACGAGATGATGTGCGGTCGCC
TGCCCTTCTACAACCAGGACCATGAGAAGCTTTTTGAGCTCATCCTCATGGAGGAGATCC
GCTTCCCGCGCACGCTTGGTCCCGAGGCCAAGTCCTTGCTTTCAGGGCTGCTCAAGAAGG
ACCCCAAGCAGAGGCTTGGCGGGGGCTCCGAGGACGCCAAGGAGATCATGCAGCATCGCT
TCTTTGCCGGTATCGTGTGGCAGCACGTGTACGAGAAGAAGGGACCCTAGGAGCCCTGGC
CATCACCCCAGCTGATGGGGTCTGCCAGCTGGGTTCGGAAGCCTGCACTCTGAGATGCTG
GGTGCCCTGTCACCAGGTGTGCTTCTGCCCCGTTCCCAGCCTGCCCCTCCCCTGAATGCC
TGTCCTAGGCTGTGTGCAGCTGGTCGGGCTGGGCAGCCCTGGGACCCAGCTGGGCACCTG
TTCTCCCATTAACACAGGGTGCCCTGGTCCTGGTCCCCGTTCCTGCCTTGAGGCCTGCCA
CCCTCCTGCCCTGCCCTCCAAGGGTATGGGGGGCCTGGGCAGTGCTCAACCTCTGCCCAG
CCTTGACCAGAGACCTTGCTAATTGACAATGGACAATGCTGGTGCCCAGCCCAGACTCTG
GGGTGGGGCAGTGCTTGAGGGGGTCCTTGACTGTGGGACCTGAGGGGCTCTCTGGCAGCT
CCTCACGTGTGCACATCACCTTATAGTCACCCTTCATCCTGGGTCATTGAGAGTCCTGTC
TGCAGCCAGATGCCAGCAGGCTGTGGTCCTGTAGTCCCTGAGCCATGGAGGCAGGGTGGG
CTCATCCTGTGCACCTTGTTCCACAGTCTCCCTCTTTCCCAATTTACAAGAAGACCAATA
AGAAAAATAAGAAAACAAGAAAGAAAAAGGAAAAATAAAGTTATCACCTCCTGGTAGCAG
GGAGGGTCTCTCAGAGCTGGGCTGCACTACCTCCTGTCGCCTGCTGGGGCTGCTGTGAGG
GCAGCTTTGCGTCTCAGCTGTTGAGGGTTGTCTCCGTGCTCCTGCACCCCTCATGTCCCT
CCCTCCCAGAGCTGCCTCTGTGGGGGGCTGGTGGCTTGCTGCTCTCTGACATCAGTCCTG
CCTGGAGACCCCTTGGAGATCCAGGTGCTTTGAAGGTCTTGAGCACACTTGAGGGTGTGC
TGGGAGTGGGGAGCGAAGCTC

Protein Sequence

>207 : length: 480
MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA