ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2066

Name

ERBB4

Synonym

ALS19|HER4|p180erbB4;erb-b2 receptor tyrosine kinase 4;ERBB4;erb-b2 receptor tyrosine kinase 4

Definition

avian erythroblastic leukemia viral (v-erb-b2) oncogene homolog 4|human epidermal growth factor receptor 4|proto-oncogene-like protein c-ErbB-4|receptor tyrosine-protein kinase erbB-4|tyrosine kinase-type cell surface receptor HER4|v-erb-a erythroblastic

Position

2q33.3-q34

Gene Type

protein-coding

Pathways and Diseases

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

Alzheimer disease-presenilin pathway;PANTHER;P00004

Pathway

ErbB4 signaling events;PID Curated;200009

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

Cadherin signaling pathway;PANTHER;P00012

Pathway

EGF receptor signaling pathway;PANTHER;P00018

Pathway

Calcium signaling pathway;KEGG PATHWAY;hsa04020

Pathway

ErbB receptor signaling network;PID Curated;200136

Pathway

g-secretase mediated erbb4 signaling pathway;PID BioCarta;100172

Disease

Schizophrenia;FunDO

Disease

Cancer;FunDO

Disease

Alzheimer's disease;FunDO

Disease

PSYCH;GAD

Disease

schizophrenia;GAD

External Links

Links to cell senescence gene database

2066

Links to epithelial mesenchymal transition gene database

2066

Links to ovarian cancer gene database

2066

Links to endometrial cancer gene database

2066

Links to iHOP

2066

Sequence Information

Nucleotide Sequence

>2066 : length: 12495
GCAGCTGGAGACCGCGGAGCGCTGGAAATGACGCTCGGAGCTTTAATTACCGCAGCCGCC
GGACAAGTGTGAGGAAAGCTGAGAGGAAAAAGAAGGACGGGATCCGGGGAGAAGCGAGAA
GCTCCCCCCGCCCCGCTCCCCTCCCGATTTGGACTGGAGGTGCAAGGAAACTGAAGAAGG
AGCAGAACATAGCCCGGCTGCGGGGAGAGGCCGGAAACCTACCGCCTCTTTGCAATCAAC
TTTTTTTGGAAACCTTTCGCCCCCCTTCCTTTTTTATTGTTGACCAACCAGTGAGAGAGA
GAGAAAGTGAGGAGGGAGCGAGCAAGCGAAGGCTCACGCGGGGAAATAGCTGCACAGTCC
GGCCCAGAGCGCCAAGCGCACACACCGAGCACACTCCCACACGCGCACACACGCGCTCAC
ACTCGCCCCCTCCTCGGGCCCCGGCCCTGGACCCGCGGGCGCGGACTCGGTCGCCCGCCC
TGGGAGTCGCCACACCGCGCGCGCCGCGCCCGCCCCCCTCGCACCCCCACGCGCGCCCGG
CTGGGGGATCTCCTCCGCGTGCCCGAAAGGGGGATATGCCATTTGGACATGTAATTGTCA
GCACGGGATCTGAGACTTCCAAAAAATGAAGCCGGCGACAGGACTTTGGGTCTGGGTGAG
CCTTCTCGTGGCGGCGGGGACCGTCCAGCCCAGCGATTCTCAGTCAGTGTGTGCAGGAAC
GGAGAATAAACTGAGCTCTCTCTCTGACCTGGAACAGCAGTACCGAGCCTTGCGCAAGTA
CTATGAAAACTGTGAGGTTGTCATGGGCAACCTGGAGATAACCAGCATTGAGCACAACCG
GGACCTCTCCTTCCTGCGGTCTGTTCGAGAAGTCACAGGCTACGTGTTAGTGGCTCTTAA
TCAGTTTCGTTACCTGCCTCTGGAGAATTTACGCATTATTCGTGGGACAAAACTTTATGA
GGATCGATATGCCTTGGCAATATTTTTAAACTACAGAAAAGATGGAAACTTTGGACTTCA
AGAACTTGGATTAAAGAACTTGACAGAAATCCTAAATGGTGGAGTCTATGTAGACCAGAA
CAAATTCCTTTGTTATGCAGACACCATTCATTGGCAAGATATTGTTCGGAACCCATGGCC
TTCCAACTTGACTCTTGTGTCAACAAATGGTAGTTCAGGATGTGGACGTTGCCATAAGTC
CTGTACTGGCCGTTGCTGGGGACCCACAGAAAATCATTGCCAGACTTTGACAAGGACGGT
GTGTGCAGAACAATGTGACGGCAGATGCTACGGACCTTACGTCAGTGACTGCTGCCATCG
AGAATGTGCTGGAGGCTGCTCAGGACCTAAGGACACAGACTGCTTTGCCTGCATGAATTT
CAATGACAGTGGAGCATGTGTTACTCAGTGTCCCCAAACCTTTGTCTACAATCCAACCAC
CTTTCAACTGGAGCACAATTTCAATGCAAAGTACACATATGGAGCATTCTGTGTCAAGAA
ATGTCCACATAACTTTGTGGTAGATTCCAGTTCTTGTGTGCGTGCCTGCCCTAGTTCCAA
GATGGAAGTAGAAGAAAATGGGATTAAAATGTGTAAACCTTGCACTGACATTTGCCCAAA
AGCTTGTGATGGCATTGGCACAGGATCATTGATGTCAGCTCAGACTGTGGATTCCAGTAA
CATTGACAAATTCATAAACTGTACCAAGATCAATGGGAATTTGATCTTTCTAGTCACTGG
TATTCATGGGGACCCTTACAATGCAATTGAAGCCATAGACCCAGAGAAACTGAACGTCTT
TCGGACAGTCAGAGAGATAACAGGTTTCCTGAACATACAGTCATGGCCACCAAACATGAC
TGACTTCAGTGTTTTTTCTAACCTGGTGACCATTGGTGGAAGAGTACTCTATAGTGGCCT
GTCCTTGCTTATCCTCAAGCAACAGGGCATCACCTCTCTACAGTTCCAGTCCCTGAAGGA
AATCAGCGCAGGAAACATCTATATTACTGACAACAGCAACCTGTGTTATTATCATACCAT
TAACTGGACAACACTCTTCAGCACAATCAACCAGAGAATAGTAATCCGGGACAACAGAAA
AGCTGAAAATTGTACTGCTGAAGGAATGGTGTGCAACCATCTGTGTTCCAGTGATGGCTG
TTGGGGACCTGGGCCAGACCAATGTCTGTCGTGTCGCCGCTTCAGTAGAGGAAGGATCTG
CATAGAGTCTTGTAACCTCTATGATGGTGAATTTCGGGAGTTTGAGAATGGCTCCATCTG
TGTGGAGTGTGACCCCCAGTGTGAGAAGATGGAAGATGGCCTCCTCACATGCCATGGACC
GGGTCCTGACAACTGTACAAAGTGCTCTCATTTTAAAGATGGCCCAAACTGTGTGGAAAA
ATGTCCAGATGGCTTACAGGGGGCAAACAGTTTCATTTTCAAGTATGCTGATCCAGATCG
GGAGTGCCACCCATGCCATCCAAACTGCACCCAAGGGTGCATAGGCTCAAGTATTGAAGA
CTGCATCGGCCTGATGGATAGGTGTAACGGTCCCACTAGTCATGACTGCATTTACTACCC
ATGGACGGGCCATTCCACTTTACCACAACATGCTAGAACTCCCCTGATTGCAGCTGGAGT
AATTGGTGGGCTCTTCATTCTGGTCATTGTGGGTCTGACATTTGCTGTTTATGTTAGAAG
GAAGAGCATCAAAAAGAAAAGAGCCTTGAGAAGATTCTTGGAAACAGAGTTGGTGGAACC
ATTAACTCCCAGTGGCACAGCACCCAATCAAGCTCAACTTCGTATTTTGAAAGAAACTGA
GCTGAAGAGGGTAAAAGTCCTTGGCTCAGGTGCTTTTGGAACGGTTTATAAAGGTATTTG
GGTACCTGAAGGAGAAACTGTGAAGATTCCTGTGGCTATTAAGATTCTTAATGAGACAAC
TGGTCCCAAGGCAAATGTGGAGTTCATGGATGAAGCTCTGATCATGGCAAGTATGGATCA
TCCACACCTAGTCCGGTTGCTGGGTGTGTGTCTGAGCCCAACCATCCAGCTGGTTACTCA
ACTTATGCCCCATGGCTGCCTGTTGGAGTATGTCCACGAGCACAAGGATAACATTGGATC
ACAACTGCTGCTTAACTGGTGTGTCCAGATAGCTAAGGGAATGATGTACCTGGAAGAAAG
ACGACTCGTTCATCGGGATTTGGCAGCCCGTAATGTCTTAGTGAAATCTCCAAACCATGT
GAAAATCACAGATTTTGGGCTAGCCAGACTCTTGGAAGGAGATGAAAAAGAGTACAATGC
TGATGGAGGAAAGATGCCAATTAAATGGATGGCTCTGGAGTGTATACATTACAGGAAATT
CACCCATCAGAGTGACGTTTGGAGCTATGGAGTTACTATATGGGAACTGATGACCTTTGG
AGGAAAACCCTATGATGGAATTCCAACGCGAGAAATCCCTGATTTATTAGAGAAAGGAGA
ACGTTTGCCTCAGCCTCCCATCTGCACTATTGACGTTTACATGGTCATGGTCAAATGTTG
GATGATTGATGCTGACAGTAGACCTAAATTTAAGGAACTGGCTGCTGAGTTTTCAAGGAT
GGCTCGAGACCCTCAAAGATACCTAGTTATTCAGGGTGATGATCGTATGAAGCTTCCCAG
TCCAAATGACAGCAAGTTCTTTCAGAATCTCTTGGATGAAGAGGATTTGGAAGATATGAT
GGATGCTGAGGAGTACTTGGTCCCTCAGGCTTTCAACATCCCACCTCCCATCTATACTTC
CAGAGCAAGAATTGACTCGAATAGGAGTGAAATTGGACACAGCCCTCCTCCTGCCTACAC
CCCCATGTCAGGAAACCAGTTTGTATACCGAGATGGAGGTTTTGCTGCTGAACAAGGAGT
GTCTGTGCCCTACAGAGCCCCAACTAGCACAATTCCAGAAGCTCCTGTGGCACAGGGTGC
TACTGCTGAGATTTTTGATGACTCCTGCTGTAATGGCACCCTACGCAAGCCAGTGGCACC
CCATGTCCAAGAGGACAGTAGCACCCAGAGGTACAGTGCTGACCCCACCGTGTTTGCCCC
AGAACGGAGCCCACGAGGAGAGCTGGATGAGGAAGGTTACATGACTCCTATGCGAGACAA
ACCCAAACAAGAATACCTGAATCCAGTGGAGGAGAACCCTTTTGTTTCTCGGAGAAAAAA
TGGAGACCTTCAAGCATTGGATAATCCCGAATATCACAATGCATCCAATGGTCCACCCAA
GGCCGAGGATGAGTATGTGAATGAGCCACTGTACCTCAACACCTTTGCCAACACCTTGGG
AAAAGCTGAGTACCTGAAGAACAACATACTGTCAATGCCAGAGAAGGCCAAGAAAGCGTT
TGACAACCCTGACTACTGGAACCACAGCCTGCCACCTCGGAGCACCCTTCAGCACCCAGA
CTACCTGCAGGAGTACAGCACAAAATATTTTTATAAACAGAATGGGCGGATCCGGCCTAT
TGTGGCAGAGAATCCTGAATACCTCTCTGAGTTCTCCCTGAAGCCAGGCACTGTGCTGCC
GCCTCCACCTTACAGACACCGGAATACTGTGGTGTAAGCTCAGTTGTGGTTTTTTAGGTG
GAGAGACACACCTGCTCCAATTTCCCCACCCCCCTCTCTTTCTCTGGTGGTCTTCCTTCT
ACCCCAAGGCCAGTAGTTTTGACACTTCCCAGTGGAAGATACAGAGATGCAATGATAGTT
ATGTGCTTACCTAACTTGAACATTAGAGGGAAAGACTGAAAGAGAAAGATAGGAGGAACC
ACAATGTTTCTTCATTTCTCTGCATGGGTTGGTCAGGAGAATGAAACAGCTAGAGAAGGA
CCAGAAAATGTAAGGCAATGCTGCCTACTATCAAACTAGCTGTCACTTTTTTTCTTTTTC
TTTTTCTTTCTTTGTTTCTTTCTTCCTCTTCTTTTTTTTTTTTTTTTTTAAAGCAGATGG
TTGAAACACCCATGCTATCTGTTCCTATCTGCAGGAACTGATGTGTGCATATTTAGCATC
CCTGGAAATCATAATAAAGTTTCCATTAGAACAAAAGAATAACATTTTCTATAACATATG
ATGGTGTCTGAAATTGAGAATCCAGTTTCTTTCCCCAGCAGTTTCTGTCCTAGCAAGTAA
GAATGGCCAACTCAACTTTCATAATTTAAAAATCTCCATTAAAGTTATAACTAGTAATTA
TGTTTTCAACACTTTTTGGTTTTTTTCATTTTGTTTTGCTCTGACCGATTCCTTTATATT
TGCTCCCCTATTTTTGGCTTTAATTTCTAATTGCAAAGATGTTTACATCAAAGCTTCTTC
ACAGAATTTAAGCAAGAAATATTTTAATATAGTGAAATGGCCACTACTTTAAGTATACAA
TCTTTAAAATAAGAAAGGGAGGCTAATATTTTTCATGCTATCAAATTATCTTCACCCTCA
TCCTTTACATTTTTCAACATTTTTTTTTCTCCATAAATGACACTACTTGATAGGCCGTTG
GTTGTCTGAAGAGTAGAAGGGAAACTAAGAGACAGTTCTCTGTGGTTCAGGAAAACTACT
GATACTTTCAGGGGTGGCCCAATGAGGGAATCCATTGAACTGGAAGAAACACACTGGATT
GGGTATGTCTACCTGGCAGATACTCAGAAATGTAGTTTGCACTTAAGCTGTAATTTTATT
TGTTCTTTTTCTGAACTCCATTTTGGATTTTGAATCAAGCAATATGGAAGCAACCAGCAA
ATTAACTAATTTAAGTACATTTTTAAAAAAAGAGCTAAGATAAAGACTGTGGAAATGCCA
AACCAAGCAAATTAGGAACCTTGCAACGGTATCCAGGGACTATGATGAGAGGCCAGCACA
TTATCTTCATATGTCACCTTTGCTACGCAAGGAAATTTGTTCAGTTCGTATACTTCGTAA
GAAGGAATGCGAGTAAGGATTGGCTTGAATTCCATGGAATTTCTAGTATGAGACTATTTA
TATGAAGTAGAAGGTAACTCTTTGCACATAAATTGGTATAATAAAAAGAAAAACACAAAC
ATTCAAAGCTTAGGGATAGGTCCTTGGGTCAAAAGTTGTAAATAAATGTGAAACATCTTC
TCATGCAATTATTTTATTATCCAACACACTAATCTTTTGATACTTTATATAATTCCCTTT
CTTCATATACTGCATCCAGTACTAGAACCATCATTATTATGTATCATTTTGAAAGAATAC
CTGATGAGATGAAGGATGAGAACAAATGACAGAGATGAGTCTCCAAGTAAAGGGGGCCTC
ACATCAATAATTAGGAAACTTAGATATAAGTCGCCCTTTTCTGAAAATTCTACCCCAAGT
CATTTAGATTTTTAAAAAATATTTCTAATGTTAAAATATTGGGACCAAATTAGAATCAAT
AGTATAAGATTAATTAATTAGAGTAAAAATATCTATTAAGGCAGAGAAAGTTTAGAGAAA
AAAATCCAAAGAAATTTGTGTTTCTTCCTATTCTGAACAAGTAAATCCATCCATCCATCC
ATCCAAACCTCCTTTATCTAACTGTGTCTACTAAAAGCACCATGTTTTGTGGGGAACACT
CAGATAAATGGAATATCATCCTCAACTTCAAAATTCTATGATCTAGGAGATTTAATTAAA
ATGACATTTTAATTTTTCTATGCGTTCCAACAATCAGATTGCATAGTCTCTTTTGTGAAT
AGCTGTCATATAATCAGTTGTACTGTAAGATATCTCCTTTAAACTCATTTGGGATATAAG
TTAAACATCCTTCAAATTGTTGATGTTGACAAACAGGATAATTTCAATAATATTATTCAA
ACATAAACTGGTCTAGGAGAATATTGCATCACTGACTAATTAGCCTATCTAGAGTCTAAC
TTCACCATTAAACCAAAAGCAGATGGTGGTCCTTGGCCAAGAATATTGGAGACATTGGAG
TTGGTTTTTTTCTAAGCTATAAGAAGTGAGGCGAGCTGAAAAAGTATGGTAGAGCAGGAG
AAGGGTTTGTGAGATTCCTTCTAGTGAAGTTCACCCTCAAACTTTTCAGGGGTAAAGACA
CAGAGTGATTCAGGGGCCACAATCTAATAGCTCAGGGCTCTCCTATCCATTCAGAGAAGT
CTCTAGGAAAAGGGATCTCATATCAGTACTTATGAAAAATTGAATATAAGCCTCCCTTTC
TAAATAAATCTGCATCGAGTCATCACAGCCCTCTTTTTGGATACTATACCTTGATTTTTT
TTTTCTGATTTACAATATGCATATGGTTTCTACTGGGCTATAGAAAGCAGAATCACTCAT
TTTGGAGAAGGAAAAAATGAATAGTTAAAACAAACTTTTAACTGTTAAGGTAACAGAAAT
GTATTTAGTGAATGTCTCTTTCCTCCTAAGAACACAAGACTTCTACATGTTGGGTAATAC
CTAGAGATGCATGTAGGAATAATCCAAAATGACCCAAATGCTTTATAATAGCACCACTTT
ATAATTCTTTTGAATGATTTCTGTAGTATATAATTGACTTCAGTTGTTTGAGTGTTTTTT
GTTTTATTTTTGTCCCCCCTGGGAAAACATATTTCAGCATGTATAAGAGGGAGAAAAAAA
GTTTCATTCCTTCCAGAGAATAACTTATTTAGTCCAGTAGGGTAGAATTTTAAAATGTCA
GTTAAAGTCTTCAAAGTGCTTGGGGGGATATCAGATTCCAGAGGCCAATTGTAGCAATTG
AAATTTGCAGAATCAATTATGTAAATCTGAGACAAATTAGTATTAAAATTACACGGAGTA
TATTTTTTAAATCACCCAACTTTGTAGATTATACCTATTTTGGGCAGGTATGGAAAAATT
TTGCAGTTAAATGATTGCCTAAAGAAAGTGGTAAACAGGTGAGGAAAGATGGCCTCTGAT
CTAGGATAGATCCAGAACCACAAAGCATCTGCACCACAAAAGGTGTTAGACTACCAAGCA
GCTCCTGGTTTTCTGCATAGTATTAGTAGCACAGCTTAGGATGAGAATCCTTTCTCCAGT
AACATTCTTAAAATAGCATGAAAAACAACGCAAAACTCAAATTTCTATTAAAACACACAA
ACTAAAATCAAGTGATTCTTTTTTGTAGATTAGGGAGAAGGACTGAATATCTAATTTAAG
AGAAGGAATAGTGTTTAAGTGTTATAGTGTGTGAGCTAATACCTTCTAAAGGAAAGACAT
GGCATGAAGATTGTGCATACTTACAATGCTAAGGAAAAATCAAGAAAAGGACTGTGTGAG
GCTCTGCTACTAGATGAAGTTGGAAGGACTATTAATGTGCTTCTTGAAGTATCAAAAATG
AAAAGAAAATTAAAATTGTTTAAGCCTGACAGGGAAGGATGTAAATACAAGTTTTTCTAG
AGCTCTCTAACCTTTATTTCAAAACTGGAATTATTCATCCATCTGTAATTGTTGATAATT
TAACTAGTATATGTAGTTCATAAGGTAATAGAAAAGGTGATCATGAAAGCATGTATATAA
CTGGACAGAACCACGATAATGCTATAAGATGTAGATTTAGTTAGGTTATCAGATGTTAAA
TGATTTTAATATTATTAAATAAATCAAACTAGAAAACTAACCACAAGTATAATGTAACAA
AGTTAAATGCAGGATATAAAAATGTAGGATGGATTTTGCATAGTAAAAAGATAAGTTTGC
CATTTAAAATTGTTGTTTGTTGGGTTTAGCTGAAAGTAGGCATATATGGTTCCACTTGGG
AAAACTTGCTTTAAAGCATTACAATGAACAATTTTTTCTCATTCTCTTATTCCTTTATCA
CTTTTTAAATGTAAAGAAAATTGTATTTATTTATTTTTTTAAATAAACACCACCTTGCAG
AATTTAATAGGCAAACATGTTACATATGACTAAGTAAGGGTCTTCAAGATGAAGTAAAGA
AAATGTAAATGTTCTATTACCTTATGCAGAGACAAAAAAAAAAAGGAGTGGTGTCATTTA
GCTAGCAAACAAACAAAATACAGTTAATTGGTGATATGTCCTTTCTTTTCTCACTATGCC
CTCTTGCCTCCAAAAATGACAACAAAGAATCACAATTTTTCTGATAAATAAATGCTAAAC
CAAGCGTTTCAAACTATTGCATTGCCATTCTTTTGGACTTTAGTTATTAGAATGATGATT
GTTATAGGGCAAATGAGAAATCCATGTGCATCAGCTTCTAGTTGTTAAAAAAACCAGATA
AATTAACTTCTACTGTATACTGTGGGCAGAGGATCCTAGAGCTGATCCTACAACATCAGC
TTCTAGTTGTTAAAAAAAAAAAAAGAAACAGATAAATTAACTTCTACTGTATATACTGTG
GGCAGAGGATCTTACTGTGCCTCTGTTTGTGTACATGGACTTCGGTGTGTATCAGTTTGA
AGGACAGCCTTGCCCCATGTAAACATATAAATGCAGATTGGTATCGCCTGGTTGCTATTT
GCTTAAGAACAAATATTATACAGATGAGATCAGGCATAATTTTAAAAGATCATTATCAGT
GGAGACCTCATTATTACTGATATTACAATGGGGCCAGTTTTTATACTTCTGGGTAGAATT
AATAAAATTTTTCTGATCCCAGAGATCTGAGTTCTCTCTGCAGTTGGAAACAAGAAGCTG
TTGTGGGCATTGTGTCGGGCCAGGGGCCCTTGTGTTTGTGTGGGCAAATATCTTTTAGCA
GTGTGAGCTGCTTTTTTCTTTTCATTAAAAGTCTCTCTAAAATAATAGAAATTTCAGATA
CTCGGTTCAAGTCTCACTGATTTTGTAGAGGTCCAAAAATGTAGGATCTGTCACTTTTGC
AGGCCCCTGCCTCACCTAATTCCTGGCCAGGTGACATTTTGGGCAGAAGTAAATGCTTCT
ATAGTCACAAGCTAAAATGACTCTAAGCCCCAATTTCACGGGGGGTATTCACATGCTTCC
TCTGGAAAATACTCTTTGACAGTCAGCTTTGCAAGTAAGTGATTACCTTGTTAGGAATCA
AAGAAAAATGTATTTCTCTCTGACCTTTAGAGGAAAATAGAATCCTTCCCTTTTTTGCCC
ATTGACACAACTGGCACTGCTCTCTTCCCTTTCTACCACCCTGGTTCAAAGTAGTCCCCC
GATGCTGTCCTGTTCCTTTCTTAAGCCATAGTGGATCTCTGAGATCCTACACCCCACTTT
GTGAAACACTGACTTCATCTTTGCCCTCGAATGCCTGATTTTTTCATAAGAGATTCTAGC
AATTTGGACACTGTTTAAGTGAACTATCAAACTACCGCATAGAGAATATTTAAGCTATTA
AAATTATGGTTTCCCATGAAGATCAATTCTCTGTGTCCTTCCCTATAGGAATTTGAGACG
AGTTAGCCCTGTGATGAATCTTGAAACTCACATATGTCCACATACACTTGGTAGAACTTC
GATTTAATCTTTACATAAAAGCTGTACATATAACCAAGAAGTTATTTTTGCCAGTAAATT
AACTTATTTGCTTTATTCATCTTATTTGGTTCCTAATCGTAAATATTTTGTAGCTGCTGT
AAATTTTTTTCTCCCAAATGAGGAGTCTTATTATCATAAAGGTAAAGGCTATTCAGCTTT
GATAACCACCTGCAATTCTTTTTTGGATCATTCATCCATCTAACAAATACATAATGAGGA
CAGTTCATGTTAATGAAAATCCATGTTGTTTAATAGAATGCCATCCTTTACCTACTTTTG
CTCTTTATGGACGTTTTTCTTTTCATGCTCTAGTGAGCTTTCCCTATATCATGAGAAGTG
GTTATATTTGTGCAAATATACAAATATAGGAAAACAAAGATTCATACCTGTAGGCAATAG
TCTAACTTGTCCAAACCACTTTGCCTTTACTGCTATTTTTATCCCCAATGCGTAGATATT
TCCCCCAGGCCTATAGCCTTTGTGAAGGAAAGCAAATCATACCTCCTGTATATTGACACG
AATCTGGTTTTCAAATGTCATTTCCAGATTTTTTAGTTAATTGGGGGTTGTCCTTTTCCC
TTAATGTGAGAGTCATTTTCCTGTATATTTCTGGATCTCTCAGGGGCTGGGAGGGGGGAG
TGAGGGGACTACAACCATAGCACTCCAAGAACCCTTTTGGGATTACTCCAGTAATCAACT
ACGAAAGTTATTTTCTAAATGTAGATATGTAAGGTGTTCTTTTAAAGTAAGGTACTTTGA
AATATGTAGCATAAACTGGTACTGCTGTTAAATGGGTCGATTATTAAACGGAGCAGCTGT
GTGAGGGCAGCTAACTTTGAATGCCTGTCTCCCTGGCTGGTGTGTCTCCTTCTCATGTTG
AGAGCACCAGGGATTGCGTGGCTGCATGCTGAAACCGCATTTTCCCATGGTGTATGACTA
GTTCATCTCTTTCTTGAGCACCATTACAAGAAGATCAAATGAAAATGAGATCAATGTGGA
AGACAATTCATAGCACAAAAAAAGTCATCTTAAATCTACTCTCAAACATTCATCTTATAC
ATGCATCAAAGTAATTTACTGACATCAGTTTGGGTGAGAGAGGGAGTCACTTTACTGAAA
AGGCAGAGGCTTAAGGTGTATACATTTGTACTCACTTCCTTATTTTCTTAACTTGTAAGC
AGAAAACAAGCCCTCTCTCTTGTGAAGTATCTTCAAAGGATTGGGGTGCAAAAATACCTT
GCTGGTAAGCCATCAATGTTTTATTTAAATCCCTGCATTCAAAGTTAGCTGCCTTTTTGA
AATAAACAAACAAAAAATACTACTGTATGTTTGAAAATGTGAATAGTATTTTTATAGCTT
GTTAAAGACATGGCTAGTTGCATTTGTAAATAAGTATAATGTTGCTTTGATTTTCTTTTG
TGGACATCTTTATTTGGAACATAATTGTCTTTAGGGTTGATTTGTATATAAGTAATTGGC
CTGTGATTGTTTCTTTTTTGGTTGGAAGTTATCATTTTGACATTACTTGTGATTCTGTGT
TCAGCACTATTGTGATGTGTTCAACCTCTGCACTCGCTTACACAATAGGATATGCCAATT
GTGTGTGGTGTAATGTTATTTTGATTTTTTTCCATGTTATTGATGAAGGATCATGCACCT
AACACATACTAACTTTTTTAATGTTAGGCATATTTTTAGTATACTTTCTCTTATTCTTTC
TTCTCCTCCAACCTTTTACCCATCCTCCTTCCTTTCCCTCATTCCTGTTGTTATTTGAGA
ATGAGGGAGAAACAGTATTTTACATTTATGTAATTAGGCTTTTCCGTTAGTTCTCAAGGA
TCCTCTTTTGGCTCTTGGGAAAGAATTGTACCTGTACAAGGCAATTATAGAATGCGAACT
GCTTTGCCTCATTCCATACTGATCATCCCAGCTGAACAATTTGAAAACTGTTCTGCCTTT
TTGTTACATGAATCTGTCAGAAATATATTTTTAATTTAATATAAATGAAATTCAATAAAA
TATGAAACAAACGTT

Protein Sequence

>2066 : length: 1323
MKPATGLWVWVSLLVAAGTVQPSDSQSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVM
GNLEITSIEHNRDLSFLRSVREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIF
LNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQDIVRNPWPSNLTLVST
NGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSG
PKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVD
SSSCVRACPSSKMEVEENGIKMCKPCTDICPKACDGIGTGSLMSAQTVDSSNIDKFINCT
KINGNLIFLVTGIHGDPYNAIEAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNL
VTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFST
INQRIVIRDNRKAENCTAEGMVCNHLCSSDGCWGPGPDQCLSCRRFSRGRICIESCNLYD
GEFREFENGSICVECDPQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGA
NSFIFKYADPDRECHPCHPNCTQGCIGSSIEDCIGLMDRCNGPTSHDCIYYPWTGHSTLP
QHARTPLIAAGVIGGLFILVIVGLTFAVYVRRKSIKKKRALRRFLETELVEPLTPSGTAP
NQAQLRILKETELKRVKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEF
MDEALIMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCV
QIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIK
WMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPIC
TIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKFFQ
NLLDEEDLEDMMDAEEYLVPQAFNIPPPIYTSRARIDSNRSEIGHSPPPAYTPMSGNQFV
YRDGGFAAEQGVSVPYRAPTSTIPEAPVAQGATAEIFDDSCCNGTLRKPVAPHVQEDSST
QRYSADPTVFAPERSPRGELDEEGYMTPMRDKPKQEYLNPVEENPFVSRRKNGDLQALDN
PEYHNASNGPPKAEDEYVNEPLYLNTFANTLGKAEYLKNNILSMPEKAKKAFDNPDYWNH
SLPPRSTLQHPDYLQEYSTKYFYKQNGRIRPIVAENPEYLSEFSLKPGTVLPPPPYRHRN
TVV