ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2065

Name

ERBB3

Synonym

ErbB-3|HER3|LCCS2|MDA-BF-1|c-erbB-3|c-erbB3|erbB3-S|p180-ErbB3|p45-sErbB3|p85-sErbB3;erb-b2 receptor tyrosine kinase 3;ERBB3;erb-b2 receptor tyrosine kinase 3

Definition

human epidermal growth factor receptor 3|proto-oncogene-like protein c-ErbB-3|receptor tyrosine-protein kinase erbB-3|tyrosine kinase-type cell surface receptor HER3|v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 3

Position

12q13

Gene Type

protein-coding

Pathways and Diseases

Pathway

neuroregulin receptor degredation protein-1 controls erbb3 receptor recycling;PID BioCarta;100173

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

ErbB2/ErbB3 signaling events;PID Curated;200119

Pathway

a6b1 and a6b4 Integrin signaling;PID Curated;200162

Pathway

role of erbb2 in signal transduction and oncology;PID BioCarta;100147

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

Cadherin signaling pathway;PANTHER;P00012

Pathway

EGF receptor signaling pathway;PANTHER;P00018

Pathway

Calcium signaling pathway;KEGG PATHWAY;hsa04020

Pathway

ErbB receptor signaling network;PID Curated;200136

Disease

Charcot-Marie-Tooth disease;FunDO

Disease

Metabolic diseases;KEGG DISEASE

Disease

Type 1 diabetes;NHGRI

Disease

diabetes, type 1;GAD

Disease

Prostate cancer;FunDO

Disease

type 1 diabetes;GAD

Disease

Type I diabetes mellitus;KEGG DISEASE;H00408

Disease

IMMUNE;GAD

Disease

Pulmonary fibrosis;FunDO

Disease

Lethal congenital contractural syndrome 2;OMIM

Disease

Cancer;FunDO

Disease

Schizophrenia;FunDO

Disease

Diabetes;KEGG DISEASE

External Links

Links to cell senescence gene database

2065

Links to epithelial mesenchymal transition gene database

2065

Links to ovarian cancer gene database

2065

Links to endometrial cancer gene database

2065

Links to iHOP

2065

Sequence Information

Nucleotide Sequence

>2065 : length: 5765
ACTCCAGCCTCGCGCGGGAGGGGGCGCGGCCGTGACTCACCCCCTTCCCTCTGCGTTCCT
CCCTCCCTCTCTCTCTCTCTCTCACACACACACACCCCTCCCCTGCCATCCCTCCCCGGA
CTCCGGCTCCGGCTCCGATTGCAATTTGCAACCTCCGCTGCCGTCGCCGCAGCAGCCACC
AATTCGCCAGCGGTTCAGGTGGCTCTTGCCTCGATGTCCTAGCCTAGGGGCCCCCGGGCC
GGACTTGGCTGGGCTCCCTTCACCCTCTGCGGAGTCATGAGGGCGAACGACGCTCTGCAG
GTGCTGGGCTTGCTTTTCAGCCTGGCCCGGGGCTCCGAGGTGGGCAACTCTCAGGCAGTG
TGTCCTGGGACTCTGAATGGCCTGAGTGTGACCGGCGATGCTGAGAACCAATACCAGACA
CTGTACAAGCTCTACGAGAGGTGTGAGGTGGTGATGGGGAACCTTGAGATTGTGCTCACG
GGACACAATGCCGACCTCTCCTTCCTGCAGTGGATTCGAGAAGTGACAGGCTATGTCCTC
GTGGCCATGAATGAATTCTCTACTCTACCATTGCCCAACCTCCGCGTGGTGCGAGGGACC
CAGGTCTACGATGGGAAGTTTGCCATCTTCGTCATGTTGAACTATAACACCAACTCCAGC
CACGCTCTGCGCCAGCTCCGCTTGACTCAGCTCACCGAGATTCTGTCAGGGGGTGTTTAT
ATTGAGAAGAACGATAAGCTTTGTCACATGGACACAATTGACTGGAGGGACATCGTGAGG
GACCGAGATGCTGAGATAGTGGTGAAGGACAATGGCAGAAGCTGTCCCCCCTGTCATGAG
GTTTGCAAGGGGCGATGCTGGGGTCCTGGATCAGAAGACTGCCAGACATTGACCAAGACC
ATCTGTGCTCCTCAGTGTAATGGTCACTGCTTTGGGCCCAACCCCAACCAGTGCTGCCAT
GATGAGTGTGCCGGGGGCTGCTCAGGCCCTCAGGACACAGACTGCTTTGCCTGCCGGCAC
TTCAATGACAGTGGAGCCTGTGTACCTCGCTGTCCACAGCCTCTTGTCTACAACAAGCTA
ACTTTCCAGCTGGAACCCAATCCCCACACCAAGTATCAGTATGGAGGAGTTTGTGTAGCC
AGCTGTCCCCATAACTTTGTGGTGGATCAAACATCCTGTGTCAGGGCCTGTCCTCCTGAC
AAGATGGAAGTAGATAAAAATGGGCTCAAGATGTGTGAGCCTTGTGGGGGACTATGTCCC
AAAGCCTGTGAGGGAACAGGCTCTGGGAGCCGCTTCCAGACTGTGGACTCGAGCAACATT
GATGGATTTGTGAACTGCACCAAGATCCTGGGCAACCTGGACTTTCTGATCACCGGCCTC
AATGGAGACCCCTGGCACAAGATCCCTGCCCTGGACCCAGAGAAGCTCAATGTCTTCCGG
ACAGTACGGGAGATCACAGGTTACCTGAACATCCAGTCCTGGCCGCCCCACATGCACAAC
TTCAGTGTTTTTTCCAATTTGACAACCATTGGAGGCAGAAGCCTCTACAACCGGGGCTTC
TCATTGTTGATCATGAAGAACTTGAATGTCACATCTCTGGGCTTCCGATCCCTGAAGGAA
ATTAGTGCTGGGCGTATCTATATAAGTGCCAATAGGCAGCTCTGCTACCACCACTCTTTG
AACTGGACCAAGGTGCTTCGGGGGCCTACGGAAGAGCGACTAGACATCAAGCATAATCGG
CCGCGCAGAGACTGCGTGGCAGAGGGCAAAGTGTGTGACCCACTGTGCTCCTCTGGGGGA
TGCTGGGGCCCAGGCCCTGGTCAGTGCTTGTCCTGTCGAAATTATAGCCGAGGAGGTGTC
TGTGTGACCCACTGCAACTTTCTGAATGGGGAGCCTCGAGAATTTGCCCATGAGGCCGAA
TGCTTCTCCTGCCACCCGGAATGCCAACCCATGGAGGGCACTGCCACATGCAATGGCTCG
GGCTCTGATACTTGTGCTCAATGTGCCCATTTTCGAGATGGGCCCCACTGTGTGAGCAGC
TGCCCCCATGGAGTCCTAGGTGCCAAGGGCCCAATCTACAAGTACCCAGATGTTCAGAAT
GAATGTCGGCCCTGCCATGAGAACTGCACCCAGGGGTGTAAAGGACCAGAGCTTCAAGAC
TGTTTAGGACAAACACTGGTGCTGATCGGCAAAACCCATCTGACAATGGCTTTGACAGTG
ATAGCAGGATTGGTAGTGATTTTCATGATGCTGGGCGGCACTTTTCTCTACTGGCGTGGG
CGCCGGATTCAGAATAAAAGGGCTATGAGGCGATACTTGGAACGGGGTGAGAGCATAGAG
CCTCTGGACCCCAGTGAGAAGGCTAACAAAGTCTTGGCCAGAATCTTCAAAGAGACAGAG
CTAAGGAAGCTTAAAGTGCTTGGCTCGGGTGTCTTTGGAACTGTGCACAAAGGAGTGTGG
ATCCCTGAGGGTGAATCAATCAAGATTCCAGTCTGCATTAAAGTCATTGAGGACAAGAGT
GGACGGCAGAGTTTTCAAGCTGTGACAGATCATATGCTGGCCATTGGCAGCCTGGACCAT
GCCCACATTGTAAGGCTGCTGGGACTATGCCCAGGGTCATCTCTGCAGCTTGTCACTCAA
TATTTGCCTCTGGGTTCTCTGCTGGATCATGTGAGACAACACCGGGGGGCACTGGGGCCA
CAGCTGCTGCTCAACTGGGGAGTACAAATTGCCAAGGGAATGTACTACCTTGAGGAACAT
GGTATGGTGCATAGAAACCTGGCTGCCCGAAACGTGCTACTCAAGTCACCCAGTCAGGTT
CAGGTGGCAGATTTTGGTGTGGCTGACCTGCTGCCTCCTGATGATAAGCAGCTGCTATAC
AGTGAGGCCAAGACTCCAATTAAGTGGATGGCCCTTGAGAGTATCCACTTTGGGAAATAC
ACACACCAGAGTGATGTCTGGAGCTATGGTGTGACAGTTTGGGAGTTGATGACCTTCGGG
GCAGAGCCCTATGCAGGGCTACGATTGGCTGAAGTACCAGACCTGCTAGAGAAGGGGGAG
CGGTTGGCACAGCCCCAGATCTGCACAATTGATGTCTACATGGTGATGGTCAAGTGTTGG
ATGATTGATGAGAACATTCGCCCAACCTTTAAAGAACTAGCCAATGAGTTCACCAGGATG
GCCCGAGACCCACCACGGTATCTGGTCATAAAGAGAGAGAGTGGGCCTGGAATAGCCCCT
GGGCCAGAGCCCCATGGTCTGACAAACAAGAAGCTAGAGGAAGTAGAGCTGGAGCCAGAA
CTAGACCTAGACCTAGACTTGGAAGCAGAGGAGGACAACCTGGCAACCACCACACTGGGC
TCCGCCCTCAGCCTACCAGTTGGAACACTTAATCGGCCACGTGGGAGCCAGAGCCTTTTA
AGTCCATCATCTGGATACATGCCCATGAACCAGGGTAATCTTGGGGAGTCTTGCCAGGAG
TCTGCAGTTTCTGGGAGCAGTGAACGGTGCCCCCGTCCAGTCTCTCTACACCCAATGCCA
CGGGGATGCCTGGCATCAGAGTCATCAGAGGGGCATGTAACAGGCTCTGAGGCTGAGCTC
CAGGAGAAAGTGTCAATGTGTAGGAGCCGGAGCAGGAGCCGGAGCCCACGGCCACGCGGA
GATAGCGCCTACCATTCCCAGCGCCACAGTCTGCTGACTCCTGTTACCCCACTCTCCCCA
CCCGGGTTAGAGGAAGAGGATGTCAACGGTTATGTCATGCCAGATACACACCTCAAAGGT
ACTCCCTCCTCCCGGGAAGGCACCCTTTCTTCAGTGGGTCTCAGTTCTGTCCTGGGTACT
GAAGAAGAAGATGAAGATGAGGAGTATGAATACATGAACCGGAGGAGAAGGCACAGTCCA
CCTCATCCCCCTAGGCCAAGTTCCCTTGAGGAGCTGGGTTATGAGTACATGGATGTGGGG
TCAGACCTCAGTGCCTCTCTGGGCAGCACACAGAGTTGCCCACTCCACCCTGTACCCATC
ATGCCCACTGCAGGCACAACTCCAGATGAAGACTATGAATATATGAATCGGCAACGAGAT
GGAGGTGGTCCTGGGGGTGATTATGCAGCCATGGGGGCCTGCCCAGCATCTGAGCAAGGG
TATGAAGAGATGAGAGCTTTTCAGGGGCCTGGACATCAGGCCCCCCATGTCCATTATGCC
CGCCTAAAAACTCTACGTAGCTTAGAGGCTACAGACTCTGCCTTTGATAACCCTGATTAC
TGGCATAGCAGGCTTTTCCCCAAGGCTAATGCCCAGAGAACGTAACTCCTGCTCCCTGTG
GCACTCAGGGAGCATTTAATGGCAGCTAGTGCCTTTAGAGGGTACCGTCTTCTCCCTATT
CCCTCTCTCTCCCAGGTCCCAGCCCCTTTTCCCCAGTCCCAGACAATTCCATTCAATCTT
TGGAGGCTTTTAAACATTTTGACACAAAATTCTTATGGTATGTAGCCAGCTGTGCACTTT
CTTCTCTTTCCCAACCCCAGGAAAGGTTTTCCTTATTTTGTGTGCTTTCCCAGTCCCATT
CCTCAGCTTCTTCACAGGCACTCCTGGAGATATGAAGGATTACTCTCCATATCCCTTCCT
CTCAGGCTCTTGACTACTTGGAACTAGGCTCTTATGTGTGCCTTTGTTTCCCATCAGACT
GTCAAGAAGAGGAAAGGGAGGAAACCTAGCAGAGGAAAGTGTAATTTTGGTTTATGACTC
TTAACCCCCTAGAAAGACAGAAGCTTAAAATCTGTGAAGAAAGAGGTTAGGAGTAGATAT
TGATTACTATCATAATTCAGCACTTAACTATGAGCCAGGCATCATACTAAACTTCACCTA
CATTATCTCACTTAGTCCTTTATCATCCTTAAAACAATTCTGTGACATACATATTATCTC
ATTTTACACAAAGGGAAGTCGGGCATGGTGGCTCATGCCTGTAATCTCAGCACTTTGGGA
GGCTGAGGCAGAAGGATTACCTGAGGCAAGGAGTTTGAGACCAGCTTAGCCAACATAGTA
AGACCCCCATCTCTTTAAAAAAAAAAAAAAAAAAAAAAAAAAAACTTTAGAACTGGGTGC
AGTGGCTCATGCCTGTAATCCCAGCCAGCACTTTGGGAGGCTGAGATGGGAAGATCACTT
GAGCCCAGAATTAGAGATAAGCCTATGGAAACATAGCAAGACACTGTCTCTACAGGGGAA
AAAAAAAAAAGAAACTGAGCCTTAAAGAGATGAAATAAATTAAGCAGTAGATCCAGGATG
CAAAATCCTCCCAATTCCTGTGCATGTGCTCTTATTGTAAGGTGCCAAGAAAAACTGATT
TAAGTTACAGCCCTTGTTTAAGGGGCACTGTTTCTTGTTTTTGCACTGAATCAAGTCTAA
CCCCAACAGCCACATCCTCCTATACCTAGACATCTCATCTCAGGAAGTGGTGGTGGGGGT
AGTCAGAAGGAAAAATAACTGGACATCTTTGTGTAAACCATAATCCACATGTGCCGTAAA
TGATCTTCACTCCTTATCCGAGGGCAAATTCACAAGGATCCCCAAGATCCACTTTTAGAA
GCCATTCTCATCCAGCAGTGAGAAGCTTCCAGGTAGGACAGAAAAAAGATCCAGCTTCAG
CTGCACACCTCTGTCCCCTTGGATGGGGAACTAAGGGAAAACGTCTGTTGTATCACTGAA
GTTTTTTGTTTTGTTTTTATACGTGTCTGAATAAAAATGCCAAAGTTTTTTTTCAGCAAA
AAAAA

Protein Sequence

>2065 : length: 1342
MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM
GNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVM
LNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNG
RSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQD
TDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTS
CVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGN
LDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGG
RSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEE
RLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEP
REFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPI
YKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLTMALTVIAGLVVIFMMLG
GTFLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVLARIFKETELRKLKVLGSGVF
GTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPG
SSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNV
LLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYGVT
VWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKE
LANEFTRMARDPPRYLVIKRESGPGIAPGPEPHGLTNKKLEEVELEPELDLDLDLEAEED
NLATTTLGSALSLPVGTLNRPRGSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPR
PVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCRSRSRSRSPRPRGDSAYHSQRHSLL
TPVTPLSPPGLEEEDVNGYVMPDTHLKGTPSSREGTLSSVGLSSVLGTEEEDEDEEYEYM
NRRRRHSPPHPPRPSSLEELGYEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTPDEDY
EYMNRQRDGGGPGGDYAAMGACPASEQGYEEMRAFQGPGHQAPHVHYARLKTLRSLEATD
SAFDNPDYWHSRLFPKANAQRT