ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2059

Name

EPS8

Synonym

DFNB102;epidermal growth factor receptor pathway substrate 8;EPS8;epidermal growth factor receptor pathway substrate 8

Definition

epidermal growth factor receptor kinase substrate 8

Position

12p12.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

CDC42 signaling events;PID Curated;200057

Pathway

Regulation of RAC1 activity;PID Curated;200165

Pathway

ErbB1 downstream signaling;PID Curated;200113

Disease

protein quantitative trait loci;GAD

Disease

Cervical cancer;FunDO

Disease

Protein quantitative trait loci;NHGRI

External Links

Links to cell senescence gene database

2059

Links to epithelial mesenchymal transition gene database

2059

Links to ovarian cancer gene database

2059

Links to endometrial cancer gene database

2059

Links to iHOP

2059

Sequence Information

Nucleotide Sequence

>2059 : length: 4125
CACTTCGCCTCAAGCGCTGGAGTCGACCAGAACTCTGCGGCTCGGCTGCCGGCAAGACCC
GGATAGCGGATTTCGCTCCTGGCTGCGGGGCGCGCACTCGCCCGCCCGCCCGCTCGCTCG
TTCCTCGCGCGGGCACTGGGCATGCGCGGCGCGCGGTTGGCACTGGCTGCGAGCGGGCGG
GCGGCTCCAGACTTCACAGGCAGCAGCTAGCGAGGCGGTCTCGCCCGGCGCGAGGCCGGC
GCTGTGCTCGCCTCGGAGATCGCTGCTCTTTAGCTGGGTGCAGAAGGCGGCTCCGCGGCT
CGCGGACGACTGGCTGGGCGCGAATCAGATTGGGGGGCTTTCTCCCGGTCCCCTCCCACC
TCGTCTGGGCTCGCGGCGTCTCCGGGGAAAGCCGTGGCCCCGAGGGCGGATCCGAGTGTC
TGTAGTGGGAAGTCTTCATGAGCTCAGTTGGCCATATTTCTGTACCTGGAATTCCCAACA
CACAAGTGAAAGACACAATGAATGGTCATATTTCTAATCATCCCAGTAGTTTTGGAATGT
ACCCATCTCAGATGAATGGCTACGGATCATCACCTACCTTTTCCCAGACGGACAGAGAAC
ATGGTTCAAAAACAAGTGCAAAGGCCCTTTATGAACAAAGGAAGAATTATGCACGGGACA
GTGTCAGCAGTGTGTCAGATATATCTCAATACCGTGTTGAACACTTGACTACCTTTGTCC
TGGATCGGAAAGATGCTATGATCACTGTTGATGATGGAATAAGGAAATTGAAATTGCTTG
ATGCCAAGGGCAAAGTGTGGACTCAAGATATGATTCTTCAAGTGGATGACAGAGCTGTGA
GCCTGATTGATTTAGAATCAAAGAATGAACTGGAGAATTTTCCTTTAAACACAATCCAGC
ACTGCCAAGCTGTGATGCATTCATGCAGCTATGATTCAGTTCTTGCACTGGTGTGCAAAG
AGCCAACCCAGAACAAGCCAGATCTTCATCTCTTCCAGTGTGATGAGGTTAAGGCAAACC
TAATTAGTGAAGATATTGAAAGTGCAATCAGTGACAGTAAAGGAGGGAAACAGAAGAGGC
GGCCCGACGCCCTGAGGATGATTTCCAATGCAGACCCTAGTATACCGCCTCCACCCAGAG
CTCCTGCCCCTGCGCCCCCTGGGACCGTCACCCAGGTGGATGTTAGAAGTCGAGTGGCAG
CCTGGTCTGCATGGGCAGCCGACCAAGGGGACTTTGAGAAACCAAGGCAGTATCATGAGC
AGGAAGAAACACCTGAGATGATGGCAGCCCGCATTGACAGAGATGTGCAAATCTTAAACC
ACATTTTGGATGACATTGAATTTTTTATCACAAAACTCCAAAAAGCAGCAGAAGCATTTT
CTGAGCTTTCTAAAAGGAAGAAAAACAAGAAAGGTAAAAGGAAAGGACCAGGAGAGGGTG
TTTTAACGCTGCGGGCAAAACCTCCACCTCCTGATGAATTTCTTGACTGTTTCCAAAAGT
TTAAACACGGATTTAACCTTCTGGCCAAACTGAAGTCTCATATTCAGAATCCTAGTGCTG
CAGATTTGGTTCACTTTTTGTTTACTCCATTAAATATGGTGGTGCAGGCAACAGGAGGTC
CTGAACTAGCCAGTTCAGTACTTAGTCCCCTATTGAATAAGGACACAATTGATTTCTTAA
ATTATACTGTCAATGGTGATGAACGGCAGCTGTGGATGTCATTGGGAGGAACTTGGATGA
AAGCCAGAGCAGAGTGGCCAAAAGAACAGTTTATTCCACCATATGTTCCACGATTCCGCA
ATGGCTGGGAGCCCCCAATGCTGAACTTTATGGGAGCCACAATGGAACAAGATCTTTATC
AACTGGCAGAATCTGTGGCAAATGTAGCAGAACATCAGCGCAAACAGGAAATAAAAAGAT
TATCCACAGAGCATTCCAGTGTATCAGAGTATCATCCAGCCGATGGCTATGCGTTCAGTA
GCAACATTTACACAAGAGGATCCCACCTGGACCAAGGGGAAGCTGCTGTTGCTTTTAAGC
CAACTTCTAATCGCCATATAGATAGAAATTATGAACCACTCAAAACACAACCCAAGAAAT
ATGCCAAATCCAAGTATGACTTTGTAGCAAGGAACAACAGTGAGCTCTCGGTTCTAAAGG
ATGATATTTTAGAGATACTTGATGATCGGAAGCAATGGTGGAAAGTTCGAAATGCAAGTG
GAGACTCTGGATTTGTGCCAAATAACATTTTGGATATTGTGAGACCTCCAGAATCTGGAT
TGGGGCGTGCTGATCCACCTTATACTCATACTATACAGAAACAAAGGATGGAGTATGGCC
CAAGACCAGCTGATACTCCCCCTGCTCCATCACCTCCTCCAACACCAGCTCCTGTTCCTG
TTCCCCTTCCCCCTTCCACTCCAGCACCTGTTCCTGTGTCAAAGGTCCCAGCAAATATAA
CACGTCAAAACAGCAGCTCCAGTGACAGTGGTGGCAGTATCGTGCGAGACAGCCAGAGAC
ACAAACAACTTCCGGTGGACCGAAGGAAATCTCAGATGGAGGAAGTGCAAGATGAACTCA
TCCACAGACTGACCATTGGTCGGAGTGCCGCTCAGAAGAAATTCCATGTGCCACGGCAGA
ACGTGCCAGTTATCAATATCACTTACGACTCCACACCAGAGGATGTGAAGACGTGGTTAC
AGTCAAAGGGATTCAACCCTGTGACTGTCAATAGTCTTGGAGTATTAAATGGTGCACAAC
TTTTCTCTCTCAATAAGGATGAACTGAGGACAGTCTGCCCTGAAGGGGCGAGAGTCTATA
GCCAAATCACTGTACAAAAAGCTGCATTGGAGGATAGCAGTGGCAGCTCCGAGTTACAAG
AAATTATGAGAAGACGACAGGAAAAAATCAGTGCTGCCGCTAGTGATTCAGGAGTGGAAT
CTTTTGATGAAGGAAGCAGTCACTAATTTGTTTGTTTGTATTTAAACTCCATTGTTTTTG
GCATTATTCCAACATGCTTTGTTTTAAGAAGCCTTGAAGGGAATGTCAGATTCATTTTTC
TTGATGTAATTTATCACCATAAAAAAAAACCCATGCAAACCTGAGTGAGCACAGGATTTG
CTTCTAGGCCCATTATTTTTATTAAAACTGAAAAAATTTAAACTGAATTTTTTGACCTTG
GAAAATATTTTTCTTACTTTACCAAGGTGAAGTTTCCTTAATTAGACTAATTATTTTATC
CCCATCCCAGGGTATAAACAGGAATTGTTTTGATAGTGGTGGAGTTATTCACTGCAACAA
AGCAACAATGTTGTCCATGATTCAAAATCTAAGCAGTTTCGATTTTGCCTGTGAATATGG
TGTCTGTCATTCAGGGCATAGCTCACTGTAGGCTAGCCTCTGCTTACTTAAGTCTCTTCT
CTGACATACTCAATGGAAGAATATTTAGATTTATTTAAAGTTCTTAATGCCAACAGTTTA
AAAAAAAATTAAAACATTTGAATGAACTGTAAAGTACAGCCATACCTTGGACATGCAAAT
ATAAATCTATGGAGCATTCTCAAGAGAGTTTGTCATGGCTCTGTTGATTGCAACTCCTTG
TATAGCTTGTATTTTGATTTAGTTTATATTCTGCTTATTATGTATACTGTGTTCTTATAT
ATGAGAAAGCACAAATGCGAAAGAGGTCATGTCTTCTCAAAATCTAGCAAAGGAAGTAGT
CTGCATTGGTGTGCATTACAGTATTTTGCTTAATGAAAGCCTCAGTTCTGAATGTTGATA
TGAGTAGTTAAAAGGAAGTGGGGCCATTTTATGTGTTTATCTGTGTCAAGTATTTCTGGT
AATAAGAAGCACTTAATTTACACATATTTTAATCCTGTGAAAGATTCCACATAGAGAAAA
GAAAGATACCTAACCTTCAACAAATGTTATTTTTGGAAACACAATTTTTGTCATTAAATG
TTATATTATTTCACATATATAAAACAGATGTTATGTAAGAATGTTGTATATTTTAACATA
AATCATTTAGAGAAATTATCTAGATTCATTAATTTTCATAGTGCCTTTTTCACATGAGTC
AGCTGGAAAGTCTGCAATAAACAGTATTTGCTGTCTGTTAATAAA

Protein Sequence

>2059 : length: 842
MSSVGHISVPGIPNTQVKDTMNGHISNHPSSFGMYPSQMNGYGSSPTFSQTDREHGSKTS
AKALYEQRKNYARDSVSSVSDISQYRVEHLTTFVLDRKDAMITVDDGIRKLKLLDAKGKV
WTQDMILQVDDRAVSLIDLESKNELENFPLNTIQHCQAVMHSCSYDSVLALVCKEPTQNK
PDLHLFQCDEVKANLISEDIESAISDSKGGKQKRRPDALRMISNADPSIPPPPRAPAPAP
PGTVTQVDVRSRVAAWSAWAADQGDFEKPRQYHEQEETPEMMAARIDRDVQILNHILDDI
EFFITKLQKAAEAFSELSKRKKNKKGKRKGPGEGVLTLRAKPPPPDEFLDCFQKFKHGFN
LLAKLKSHIQNPSAADLVHFLFTPLNMVVQATGGPELASSVLSPLLNKDTIDFLNYTVNG
DERQLWMSLGGTWMKARAEWPKEQFIPPYVPRFRNGWEPPMLNFMGATMEQDLYQLAESV
ANVAEHQRKQEIKRLSTEHSSVSEYHPADGYAFSSNIYTRGSHLDQGEAAVAFKPTSNRH
IDRNYEPLKTQPKKYAKSKYDFVARNNSELSVLKDDILEILDDRKQWWKVRNASGDSGFV
PNNILDIVRPPESGLGRADPPYTHTIQKQRMEYGPRPADTPPAPSPPPTPAPVPVPLPPS
TPAPVPVSKVPANITRQNSSSSDSGGSIVRDSQRHKQLPVDRRKSQMEEVQDELIHRLTI
GRSAAQKKFHVPRQNVPVINITYDSTPEDVKTWLQSKGFNPVTVNSLGVLNGAQLFSLNK
DELRTVCPEGARVYSQITVQKAALEDSSGSSELQEIMRRRQEKISAAASDSGVESFDEGS
SH