ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2020

Name

EN2

Synonym

engrailed homeobox 2;EN2;engrailed homeobox 2

Definition

engrailed homolog 2|engrailed-2|homeobox protein en-2|homeobox protein engrailed-2|hu-En-2

Position

7q36

Gene Type

protein-coding

Pathways and Diseases

Pathway

Wnt signaling pathway;PANTHER;P00057

Disease

PSYCH;GAD

Disease

autism spectrum disorder;GAD

Disease

Behavior disease;FunDO

Disease

Pervasive development disorder;FunDO

Disease

Autistic disorder;FunDO

Disease

Autism, susceptibility to, 10;OMIM

External Links

Links to cell senescence gene database

2020

Links to epithelial mesenchymal transition gene database

2020

Links to ovarian cancer gene database

2020

Links to endometrial cancer gene database

2020

Links to iHOP

2020

Sequence Information

Nucleotide Sequence

>2020 : length: 3405
TCTCTCATCGTCTGGGCGAGCGGGGCGGCTCGTGGTGTTTCTAACCCAGTTCGTGGATTC
AAAGGTGGCTCCGCGCCGAGCGCGGCCGGCGACTTGTAGGACCTCAGCCCTGGCCGCGGC
CGCCGCGCACGCCCTCGGAAGACTCGGCGGGGTGGGGGCGCGGGGGTCTCCGTGTGCGCC
GCGGGAGGGCCGAAGGCTGATTTGGAAGGGCGTCCCCGGAGAACCAGTGTGGGATTTACT
GTGAACAGCATGGAGGAGAATGACCCCAAGCCTGGCGAAGCAGCGGCGGCGGTGGAGGGA
CAGCGGCAGCCGGAATCCAGCCCCGGCGGCGGCTCGGGCGGCGGCGGCGGTAGCAGCCCG
GGCGAAGCGGACACCGGGCGCCGGCGGGCTCTGATGCTGCCCGCGGTCCTGCAGGCGCCC
GGCAACCACCAGCACCCGCACCGCATCACCAACTTCTTCATCGACAACATCCTGCGGCCC
GAGTTCGGCCGGCGAAAGGACGCGGGGACCTGCTGTGCGGGCGCGGGAGGAGGAAGGGGC
GGCGGAGCCGGCGGCGAAGGCGGCGCGAGCGGTGCGGAGGGAGGCGGCGGCGCGGGCGGC
TCGGAGCAGCTCTTGGGCTCGGGCTCCCGAGAGCCCCGGCAGAACCCGCCATGTGCGCCC
GGCGCGGGCGGGCCGCTCCCAGCCGCCGGCAGCGACTCTCCGGGTGACGGGGAAGGCGGC
TCCAAGACGCTCTCGCTGCACGGTGGCGCCAAGAAAGGCGGCGACCCCGGCGGCCCCCTG
GACGGGTCGCTCAAGGCCCGCGGCTTGGGCGGCGGCGACCTGTCGGTGAGCTCGGACTCG
GACAGCTCGCAAGCCGGCGCCAACCTGGGCGCGCAGCCCATGCTCTGGCCGGCGTGGGTC
TACTGTACGCGCTACTCGGACCGGCCTTCTTCAGGTCCCAGGTCTCGAAAACCAAAGAAG
AAGAACCCGAACAAAGAGGACAAGCGGCCGCGCACGGCCTTTACCGCCGAGCAGCTGCAG
AGGCTCAAGGCCGAGTTCCAGACCAACAGGTACCTGACGGAGCAGCGGCGCCAGAGCCTG
GCGCAGGAGCTGAGCCTCAACGAGTCACAGATCAAGATTTGGTTCCAGAACAAGCGCGCC
AAGATCAAGAAGGCCACGGGCAACAAGAACACGCTGGCCGTGCACCTCATGGCACAGGGC
TTGTACAACCACTCCACCACAGCCAAGGAGGGCAAGTCGGACAGCGAGTAGGGCGGGGGG
CATGGAGGCCAGGTCTCAGTCCGCGCTAAACAATGCAATAATTTAAAATCATAAAGGGCC
AGTGTATAAAGATTATACCAGCATTAATAGTGAAAATATTGTGTATTAGCTAAGGTTCTG
AAATATTCTATGTATATATCATTTACAGGTGGTATAAAATCCAAAATATCTGACTATAAA
ATATTTTTTTGAGTTTTTTGTGTTTATGAGATTATGCTAATTTTATGGGTTTTTTTCTTT
TTTGCGAAGGGGGCTGCTTAGGGTTTCACCTTTTTTTAATCCCCTAAGCTCCATTATATG
ACATTGGACACTTTTTTATTATTCCAAAAGAAGAAAAAATTAAAACAACTTGCTGAAGTC
CAAAGATTTTTTATTGCTGCATTTCACACAACTGTGAACCGAATAAATAGCTCCTATTTG
GTCTATGACTTCTGCCACTTTGTTTGTGTTGGCTTGGTGAGGACAGCAGGAGGGGCCCAC
ACCTCAAGCCTGGACCAGCCACCTCAAGGCCTTGGGGAGCTTAGGGGACCTGGTGGGAGA
GAGGGGACTTCCAGGGTCCTTGGGCCAGTTCTGGGATTTGGCCCTGGGAAGCAGCCCAGC
GTACCCCAGGCCTGCTCTGGGAAGTCGGCTCCATGCTCACCAGCAGCCGCCCAGGCCCGC
AGCCTCACCCGGCTCCCTCTCCTCACCCTCCTGCACCTAACTCCCTCCTCCTTCTCCTTT
TTCCTCCTCTTCCTCCTTCCTCCTTCCTCCTGCTCCTCCTTTCTTCTTCTTTTTCTTCTC
CTCCTCCTCCTTCCTTCCTCCTCCTCCTTCTCTTTCCTCCTCCTCCTCACCAAGGGCCCA
ACCGTGTGCATACATCGTCTGCGTCTGTGGTCTGTGTCGCTGTCCCCAGTCCCACCGCAG
TCCTGCCGCAGGCCTAACCCTCCTGCCCTGGGCACTGCCTCCATGCAGAAGCGCTTCGAG
GTTCTGGGGCTAAAGGCCTGGGGTGTGTGGCCTAAAGCCCAAGAGCGGTGGGGCGACCCT
CCTTTTGGCTTGGCCCCAGGAATTTCCTGTGACTCCACCAGCCATCATGGGTGCCAGCCA
GGGTCCCAGAAATGAGGCCATGGCTCACTGTTTCTGGGCGGGCAGAAGGCTCTGTAGAGG
GAGATGGCATCATCTATCTTCCTTTCCTTTTTCTTTTCTTCCCTATTTTTTTCTTTTTTT
CCTTTATTTTTTTCTTTTCTTGGAGTGGCTGCTTCTGCTATAGAGAACATTCTTCCAAGA
TAAATATGTGTGTTTACACATATGTCTGCATGCATGTGAACACACACACACACACACACA
CACCAGGCGTGTTTGAGTCCACAGTTCTGAAACATGTGGCTACCTTGTCTTTCAAAAGAA
CTCAGAATCCTCCAGGATCTAGAAGAAGGAAGAAAGTGTGTAAATAATCATTTCTTATCA
TCACTTTTTGTCTTTTCTTGTTTTTTAAAATATACATTTTATTTTTGAAGGTGTGGTACA
GTGTAAATTAAATATATTCAATATATTTCCCACCAAGTACCTATATATGTATATAAACAA
ACACATTATCTATATATAACGCCACACTGTCTTCTGTTTAGTGTATGGGGAAAGACCAAT
CCAACTGTCCATCTGTGGCTGGGACAGCCCAGGGGGTGTGCCCACGGCTGACCCAGGGGT
GTGCACACGGCTGAGCTGGGAGTCCCGCTGGTCTCCCTGAGGACTGAGGGTGAACTTCGC
TCTTTGCCTTAAACCTCTTTATTTCATTGCAGTAATAGTTTTACGTTGTACATAATAGTG
TAAACCTTTTTAAAAAGGAAAGTATAAAAACAAAAGTTGTAATTTAAAAGTCTGAATAAC
CATCTGCTGCTTAGGAAACTCAATGAAATGACATGCCTTTTTAGCAGGAAGCAAAGTTGG
TTTCTGTTTTTTGTTTTCTTTGTTGTTTTAGTTTATAAAACATGTGCATTTTACAGTTCC
AGTATCAAATATTTATAATCTTATGAGAAATGAATGAATGTTTCTATTTACAACTGTGCT
TATCAAAATTGTGAACACCCCCACCCCCGCATTTTTGTGTGTTGAAATTCTTGAAGGTTA
CATTAAATAAAACAAAATCTCTTTATTATAAAATAAAAAAAAAAA

Protein Sequence

>2020 : length: 333
MEENDPKPGEAAAAVEGQRQPESSPGGGSGGGGGSSPGEADTGRRRALMLPAVLQAPGNH
QHPHRITNFFIDNILRPEFGRRKDAGTCCAGAGGGRGGGAGGEGGASGAEGGGGAGGSEQ
LLGSGSREPRQNPPCAPGAGGPLPAAGSDSPGDGEGGSKTLSLHGGAKKGGDPGGPLDGS
LKARGLGGGDLSVSSDSDSSQAGANLGAQPMLWPAWVYCTRYSDRPSSGPRSRKPKKKNP
NKEDKRPRTAFTAEQLQRLKAEFQTNRYLTEQRRQSLAQELSLNESQIKIWFQNKRAKIK
KATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSE