ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2017

Name

CTTN

Synonym

EMS1;cortactin;CTTN;cortactin

Definition

1110020L01Rik|amplaxin|ems1 sequence (mammary tumor and squamous cell carcinoma-associated (p80/85 src substrate)|oncogene EMS1|src substrate cortactin

Position

11q13

Gene Type

protein-coding

Pathways and Diseases

Pathway

Bacterial invasion of epithelial cells;KEGG PATHWAY;hsa05100

Pathway

Pathogenic Escherichia coli infection;KEGG PATHWAY;hsa05130

Pathway

N-cadherin signaling events;PID Curated;200180

Pathway

Syndecan-3-mediated signaling events;PID Curated;200170

Pathway

Tight junction;KEGG PATHWAY;hsa04530

Pathway

Shigellosis;KEGG PATHWAY;hsa05131

Pathway

E-cadherin signaling in the nascent adherens junction;PID Curated;200105

Pathway

agrin in postsynaptic differentiation;PID BioCarta;100252

Pathway

FGF signaling pathway;PID Curated;200189

Disease

Infection;FunDO

Disease

Cancer;FunDO

External Links

Links to cell senescence gene database

2017

Links to epithelial mesenchymal transition gene database

2017

Links to ovarian cancer gene database

2017

Links to endometrial cancer gene database

2017

Links to iHOP

2017

Sequence Information

Nucleotide Sequence

>2017 : length: 3319
GATGCGGCCCCGCCCCCGCCCTCGGAACCGGAAGTAGAGCCTGGTGCCTGGGAGCGGCTG
GCGCGGCGGAATCCAGGGCCGACCCGGGCCGGACCGACCCCAGGCGGCGACGGAATCAGT
CCCCAATGCCTGGAAATTCCTCATTGGATTACTGTGTTTTAAACAGAATTTCGTGAACAG
CCTTTTATCTCCAAGCGGAAAGAAAGATGTGGAAAGCTTCAGCAGGCCACGCTGTGTCCA
TCGCCCAGGATGACGCGGGGGCCGATGACTGGGAGACCGACCCTGATTTTGTGAATGATG
TGAGTGAGAAGGAGCAAAGATGGGGTGCCAAGACGGTGCAGGGCTCCGGGCACCAGGAGC
ATATCAACATACACAAGCTGAGGGAGAATGTCTTTCAAGAGCATCAGACCCTTAAGGAGA
AGGAACTTGAAACAGGACCAAAAGCTTCCCATGGCTATGGAGGGAAATTTGGTGTGGAAC
AAGACCGAATGGATAAGTCAGCTGTCGGCCACGAATATCAGTCGAAACTTTCCAAGCACT
GCTCGCAGGTGGACTCGGTCCGTGGCTTCGGAGGCAAGTTTGGTGTCCAGATGGACAGAG
TTGATCAGTCTGCTGTAGGCTTTGAATACCAGGGGAAGACTGAGAAGCATGCCTCCCAGA
AAGACTACTCCAGTGGTTTTGGCGGCAAGTATGGCGTGCAGGCCGACCGAGTAGACAAGA
GCGCGGTGGGCTTCGACTACCAGGGCAAGACGGAGAAGCACGAGTCACAGAGAGATTACT
CCAAAGGTTTCGGCGGCAAATACGGTATCGACAAGGACAAAGTGGATAAGAGCGCCGTTG
GCTTTGAGTATCAAGGCAAAACGGAGAAGCACGAGTCCCAGAAAGACTATGTGAAAGGGT
TTGGAGGAAAATTTGGTGTGCAGACAGACAGACAAGACAAATGTGCCCTTGGCTGGGATC
ACCAGGAGAAATTGCAGCTGCATGAATCCCAAAAAGATTATAAGACTGGTTTTGGAGGCA
AATTCGGTGTTCAGTCGGAGAGGCAGGACTCCGCTGCTGTGGGGTTTGATTACAAGGAGA
AGCTGGCCAAGCACGAGTCCCAGCAAGACTACTCCAAAGGATTCGGCGGGAAGTATGGGG
TGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCT
CTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAG
CTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGG
AGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGG
AGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCG
AGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGA
GCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTG
ACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAA
GCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACG
ATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCT
CATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCG
GGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGG
GCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTT
TGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGG
TGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAA
TGTTTATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTA
ATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAATTGACTGTCACGCGGC
AGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGT
CGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAG
GACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGAGGAGAGGACTGGGC
CTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGG
GAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACC
CTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTACCCATCCCCTGATGCCC
AGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTC
CTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTC
TGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTCACCCATATGGTCCCTG
GGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTG
GGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGG
GGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTTTGATCAGTTGAAGGCT
AGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGA
CACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGG
AGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAG
GTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTC
CTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTA
TATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGGTATGATTTTTTTAAAT
TAAAGAATTCAGAATAAACATTTTTTGATCCACTTGCGTGAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAA

Protein Sequence

>2017 : length: 634
MWKASAGHAVSIAQDDAGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRE
NVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRG
FGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQG
KTEKHESQRDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQT
DRQDKCALGWDHQEKLQLHESQKDYSKGFGGKYGVQKDRMDKNASTFEDVTQVSSAYQKT
VPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARA
KTQTPPVSPAPQPTEERLPSSPVYEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREAS
SQQGLAYATEAVYESAEAPGHYPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDD
IITNIEMIDDGWWRGVCKGRFRELAFSCVRVALVPIKCSRDLPGQARGLRSALWRVGRKD
CPRRGASSRVSLLGRRGLGLMEVNPELSHPEHRSCHVRWEICLCHTVTARRIRKLISFLR
SREAGPVPSCSQVGGVSFQKVTWKCLGTWVPECP