ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2004

Name

ELK3

Synonym

ERP|NET|SAP-2|SAP2;ELK3, ETS-domain protein (SRF accessory protein 2);ELK3;ELK3, ETS-domain protein (SRF accessory protein 2)

Definition

ETS domain-containing protein Elk-3|ETS-related protein ERP|ETS-related protein NET|SRF accessory protein 2|serum response factor accessory protein 2

Position

12q23

Gene Type

protein-coding

Pathways and Diseases

Pathway

Interleukin signaling pathway;PANTHER;P00036

External Links

Links to cell senescence gene database

2004

Links to epithelial mesenchymal transition gene database

2004

Links to ovarian cancer gene database

2004

Links to endometrial cancer gene database

2004

Links to iHOP

2004

Sequence Information

Nucleotide Sequence

>2004 : length: 4295
ACAGCCGCGGCCGGGGCGCGCGGCGCGGGGCGGAAAAGCCTGTTTACACAGACTGCACAC
CGCCTGGGGAATAATGCAGTAAAGGAAGTGAGCCGGCTCGGCCTGACTGCTCCAACTTCC
TGCTCTCACACACACCAGAGGGGAAAAAAAAAGAGGAGCGAGAGAAAGAAAAAAAGGGGG
AAAAATCAGGATCTCATTACAAGAGCCACAGACCGTCTGCAGACGCCTGTCAGCATGGAA
AGTCGGGGGCTTTCGCCCGGGTCCTCCTAGAAATTCCCCCCGAAGAAGACTCCCCCACAT
CTGGAAGACCAGTATGGTGCTGTGAAATGTTGCAAAACATGACCTGATGACAACCCAAAA
CACTTCATAGAAAACTATCCAAGAATGTGACTTCCTGGAGTAGAGTCTTTTTTCACTGAG
GGTATGGAGAGTGCAATCACGCTGTGGCAGTTCCTGTTGCAGTTGCTGCTGGATCAGAAA
CATGAGCATTTGATCTGCTGGACCTCGAACGATGGTGAATTCAAGCTCCTCAAAGCAGAA
GAAGTGGCCAAGCTGTGGGGACTCCGAAAAAACAAAACAAATATGAACTATGATAAGCTG
AGCAGAGCCCTGCGATACTATTATGACAAGAACATCATCAAGAAGGTGATCGGGCAGAAG
TTTGTGTACAAGTTTGTCTCTTTCCCGGAGATCCTGAAGATGGATCCTCACGCGGTGGAG
ATCAGCCGGGAGAGCCTTCTGCTGCAGGACAGCGACTGCAAGGCGTCTCCGGAGGGCCGC
GAGGCCCACAAACACGGCCTGGCCGCCCTCAGAAGCACGAGCCGCAACGAATACATCCAC
TCAGGCCTGTACTCGTCCTTCACCATTAATTCCCTGCAGAACCCACCAGACGCCTTCAAG
GCCATCAAGACGGAGAAGCTGGAGGAGCCGCCCGAAGACAGCCCCCCCGTGGAAGAAGTC
AGGACTGTGATCAGGTTTGTGACCAATAAAACCGACAAGCACGTCACCAGGCCGGTGGTG
TCCCTGCCTTCCACGTCAGAGGCTGCGGCGGCGTCCGCCTTCCTGGCCTCGTCCGTCTCG
GCCAAGATCTCCTCTTTAATGTTGCCAAACGCTGCCAGTATTTCATCCGCCTCACCCTTC
TCATCTCGGTCCCCGTCCCTGTCCCCCAACTCACCCCTCCCTTCTGAACACAGAAGCCTC
TTCCTGGAGGCCGCCTGCCATGACTCCGATTCCCTGGAGCCCTTGAACCTGTCATCGGGC
TCCAAGACCAAGTCTCCATCTCTTCCCCCAAAGGCCAAAAAACCCAAAGGCTTGGAAATC
TCAGCGCCCCCGCTGGTGCTCTCCGGCACCGACATCGGCTCCATCGCCCTCAACAGCCCA
GCCCTCCCCTCGGGATCCCTCACCCCAGCCTTCTTCACCGCACAGACACCAAATGGATTG
CTTCTGACTCCGAGTCCACTGCTCTCCAGCATACATTTCTGGAGCAGCCTTAGTCCAGTT
GCTCCGCTGAGTCCTGCCAGGCTGCAAGGGCCAAGCACGCTGTTCCAGTTCCCCACACTG
CTTAATGGCCACATGCCAGTGCCAATCCCCAGTCTGGACAGAGCTGCTTCTCCAGTACTG
CTTTCTTCAAACTCTCAGAAATCCTGATGACGTCTGGCCACAATTAAGGACTCATTAACT
GATGAAACAAATTTGTCCCCACGGGCTAGTTTACCTGTGTCGTGAGAAGGACATTGTGAA
ACTCTTGTTAATTTGGTTTGCACTTTTCATAACATGGATAGTCTAGATTTATGTTAGCAT
TTTAAAAACTGTTTTTGATATATTCAAGTATATATGAAAATCTGTTTGGCATTAAGTGAA
TTTTAATGTTTTTGTTTTTATATCCTTTTAGCTCTTAAGTGTTGAACACTGTTGACAGTG
AAGAACTTTTCTTAATGGTTTTCAGTATAACTAATAAGGATGTGAAGCTTTTTTCTCTTT
AGTTCTGAGTATGCTAAACTGTGTGCTTATATAGACTATAACCAGTTGTGCCTTCCTTCG
CATTTAATGTAAATGAATGATTTATATATTTTTTAGTATTAAGAGGAAATGTTTGAAAGA
TGAAAATTAGTATCAAACAGCTCTCTAGTAGAATTTCATTATTTTTCACCAGTGGGCAAT
ATGAAAGCATATATCACGTTTTGTTTTACTTTCAATTGTATAAGAATTGCCTTAGAACCT
CTTTTGAACTGAAATTCAGTAAATGTCCAAGTAATGTTTTTATAATAAACTAAGCCATAT
TTAGACAATAAACATTGATAAAAGAAAATGTTCTAAAGTACATTTTCAAAAGAATGGACC
TTGAAAGGCTAGCCTCCTTAGCTGTTTACAGTATCTTATCTTTTAGATGCCTCCCAGACA
AAAATCTGAGATGGAAAAGCTACATCAAGTTCATGCTATTCCAGGCCCAAGAATATCTCC
TAGGTTAGCATATTCTTATTTCAAAAAATTAGCCCTGGTTTTCTCAGTTTTCCATAGGGA
ATCCCGACCATCTGATATATTTACTGTGTCAGTATAAGTAAGTTGGGGTTCCCCTGGAAC
TATAATTAACATTTAAAAAATCTAATGCTTTAGAAGAAGCTCACAGAGTGGTGATGAACC
CAAACAACAAAGAAACCATTTTTAACACTAGGTATCTTCATCAGTATAGGTAGGTGTTCA
CAATTTTTGATGGATCAAAAACTTGCTGTAATACAAATAGAGAGTGGAGGTACTAAAGGC
CTTGCTTGTGGAAACTGAGAGAGGATACACTGCTTTATGTATTACTAAAGTTAGGGGAGA
ATGAAGGAAATCTGACAGATGAAAAATTCTACAGGAACCTCATCATCGTGGAACTGAACT
GATGATAACTTGGAACACTCCAGTAAATTCTGTTGTGTAATGTAATTTGGAGCAGTGATA
ATACAGACATATTTTCTGTTCCATCAGAAAATCAGCAGGCACCAGTCCAAAGGTACCACA
CCTGTACATGAAGAAGGAAAGTTCTAATACAAGAAAACTGAAAAGCACCAAGCTTTAAAT
TCAAGATTAATTACAATCCTTAACTATAAGTGATGATAAAAACTAACTTGAAATGTGACT
AAATAACTGATCCAAACTGGGCATTAAGTGGCAGGATTATGAGAAAGGATAAAAAAAGAG
ATTTGAGAAAACACATTTCTTGAATTTTCAGAAAAAAATCTAGACTATTGCTTTGACACT
TAGAAATTCTGAGGTTTTTCAATTGGAATTGAGCATCTCTGTATGTGGGGATGTGGGCCC
TTATCAAGGGATAAAAATCCAAACACTCTAACATGCCTCCTTGACTGTAAAGTAATGACA
CTGGTTCCAAAATTCACAAATAATAGACACTACTGTCCCCCCACCCCCACCCCATAGGCT
AAGAATAATTCTGTACCAGAATAAAAGGAGCTGGTCCAGGGAACTGATATTTACTGAACA
TACAAAGTTAGTGCTAGAAGGGGCCTTTGAGAATGCTTCCCGCCACCTGTTTCCAGCTCA
AGACAGGTGCACAGCAGAAGCTGGGAGTTGCCTATGGCTGCACAGCTCACTGAAGGTAGA
ACAATGATTGGTGCTCAGTCCAATTCTGTCTCCCCCATGCCTAGCTGTTAAGTAATTACT
GGTTCAAAACTACGTGTTATTAGTAAAACAAACAAAACAGATAAAGACAGCATTTAAAAC
TGTGTTGTCAGATAAGAGAACACATCCAAAATGCATGATTCTTACAAACTAAAGGAAGTT
AATGTGCAAAAATCTCAACCAAAACTACTATTTTTAGTATACTTGTTTACGTAAATGCTG
ATTGGAAATATTTAAATGACTATAGATCTGATTCTTTCTTTTCCTTTGGAAACTGGGATT
AATGTATGCTCTAGATCCATTTATTAGAAATGCAAAAATACTACAATTTTTTGATGGATG
AAAATACTCCTGTAACACAAACAGAGAACTGGAGGAACTGAAGAATAACTCACTCATATA
GCTCTGCCTCATTCTGTGTGTGTGTGCATGTGTGTGTTAGCAGAGGTATTTTACTCAGAA
AATAGGTTTCAAAGAACATTAATGACTTTCTTTTCCCTTTTATGTCTGCTTAATCAGTGT
TAAACTGCTATGGGAAAAGTTTTATAGAACTATATAACCTGAATGTTGGTCTCTTTGTAC
ACATCTTTTCTATGACTGCAAATCTTCACTTTATGTATCATTTTTACTGTCATATTATTT
TTGTTCAATAAAAACTTTGTGATAAAAGGTGTTTA

Protein Sequence

>2004 : length: 407
MESAITLWQFLLQLLLDQKHEHLICWTSNDGEFKLLKAEEVAKLWGLRKNKTNMNYDKLS
RALRYYYDKNIIKKVIGQKFVYKFVSFPEILKMDPHAVEISRESLLLQDSDCKASPEGRE
AHKHGLAALRSTSRNEYIHSGLYSSFTINSLQNPPDAFKAIKTEKLEEPPEDSPPVEEVR
TVIRFVTNKTDKHVTRPVVSLPSTSEAAAASAFLASSVSAKISSLMLPNAASISSASPFS
SRSPSLSPNSPLPSEHRSLFLEAACHDSDSLEPLNLSSGSKTKSPSLPPKAKKPKGLEIS
APPLVLSGTDIGSIALNSPALPSGSLTPAFFTAQTPNGLLLTPSPLLSSIHFWSSLSPVA
PLSPARLQGPSTLFQFPTLLNGHMPVPIPSLDRAASPVLLSSNSQKS