ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2002

Name

ELK1

Synonym

ELK1, member of ETS oncogene family;ELK1;ELK1, member of ETS oncogene family

Definition

ETS domain-containing protein Elk-1|ETS-like gene 1|tyrosine kinase (ELK1) oncogene

Position

Xp11.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

mapkinase signaling pathway;PID BioCarta;100113

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

Ras signaling in the CD4+ TCR pathway;PID Curated;200088

Pathway

igf-1 signaling pathway;PID BioCarta;100136

Pathway

signaling pathway from g-protein families;PID BioCarta;100153

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

Endometrial cancer;KEGG PATHWAY;hsa05213

Pathway

pdgf signaling pathway;PID BioCarta;100077

Pathway

Insulin/IGF pathway-mitogen activated protein kinase kinase/MAP kinase cascade;PANTHER;P00032

Pathway

Toll receptor signaling pathway;PANTHER;P00054

Pathway

BCR signaling pathway;PID Curated;200005

Pathway

PDGFR-alpha signaling pathway;PID Curated;200140

Pathway

t cell receptor signaling pathway;PID BioCarta;100022

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

PDGF signaling pathway;PANTHER;P00047

Pathway

egf signaling pathway;PID BioCarta;100181

Pathway

HIF-2-alpha transcription factor network;PID Curated;200030

Pathway

Ras Pathway;PANTHER;P04393

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

Insulin signaling pathway;KEGG PATHWAY;hsa04910

Pathway

Parkinson disease;PANTHER;P00049

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

p38 mapk signaling pathway;PID BioCarta;100085

Pathway

toll-like receptor pathway;PID BioCarta;100013

Pathway

Trk receptor signaling mediated by the MAPK pathway;PID Curated;200182

Pathway

Leishmaniasis;KEGG PATHWAY;hsa05140

Pathway

Downstream signaling in naive CD8+ T cells;PID Curated;200184

Pathway

ErbB1 downstream signaling;PID Curated;200113

Pathway

angiotensin ii mediated activation of jnk pathway via pyk2 dependent signaling;PID BioCarta;100236

Pathway

bcr signaling pathway;PID BioCarta;100227

Pathway

fmlp induced chemokine gene expression in hmc-1 cells;PID BioCarta;100162

Pathway

erk1/erk2 mapk signaling pathway;PID BioCarta;100170

Pathway

GnRH signaling pathway;KEGG PATHWAY;hsa04912

Pathway

fc epsilon receptor i signaling in mast cells;PID BioCarta;100165

Pathway

nerve growth factor pathway (ngf);PID BioCarta;100096

Pathway

Prion diseases;KEGG PATHWAY;hsa05020

Pathway

S1P2 pathway;PID Curated;200181

Pathway

tpo signaling pathway;PID BioCarta;100012

Pathway

Angiopoietin receptor Tie2-mediated signaling;PID Curated;200066

Pathway

Oxidative stress response;PANTHER;P00046

Pathway

Interleukin signaling pathway;PANTHER;P00036

Disease

Brain tumor;FunDO

Disease

Prostate cancer;FunDO

External Links

Links to cell senescence gene database

2002

Links to epithelial mesenchymal transition gene database

2002

Links to ovarian cancer gene database

2002

Links to endometrial cancer gene database

2002

Links to iHOP

2002

Sequence Information

Nucleotide Sequence

>2002 : length: 2934
CTCGGGCCCACGTGAGCTGTAGGGAAACGCAGGGGCGGCTTCTAGGTGCTGCCGCCGCCA
CCGCCACCACCACCTCCACCGCCGCCTCGGAACCCAGGCCTGGGGGGCGGTGGGGCCGCG
TATGGAGCCCCCGCCCCCCGGAGCTGCCAACATTGCCAACGCCACCGCCACGCTACACAC
AGCCTCAACTTTCAGGAGACCCGTCCGTGGCCTTATTTATTCCACCCTTCCTGTACATCG
TAGCGAATCAATCCGTGGCGCCGCACTCCTCCGCATCCCTCTTTAACAGTACCCCTGGGA
TGGCGTGAGCACTCCCCCAGCGATGGACCCATCTGTGACGCTGTGGCAGTTTCTGCTGCA
GCTGCTGAGAGAGCAAGGCAATGGCCACATCATCTCCTGGACTTCACGGGATGGTGGTGA
ATTCAAGCTGGTGGATGCAGAGGAGGTGGCCCGGCTGTGGGGGCTACGCAAGAACAAGAC
CAACATGAATTACGACAAGCTCAGCCGGGCCTTGCGGTACTACTATGACAAGAACATCAT
CCGCAAGGTGAGCGGCCAGAAGTTCGTCTACAAGTTTGTGTCCTACCCTGAGGTCGCAGG
GTGCTCCACTGAGGACTGCCCGCCCCAGCCAGAGGTGTCTGTTACCTCCACCATGCCAAA
TGTGGCCCCTGCTGCTATACATGCCGCCCCAGGGGACACTGTCTCTGGAAAGCCAGGCAC
ACCCAAGGGTGCAGGAATGGCAGGCCCAGGCGGTTTGGCACGCAGCAGCCGGAACGAGTA
CATGCGCTCGGGCCTCTATTCCACCTTCACCATCCAGTCTCTGCAGCCGCAGCCACCCCC
TCATCCTCGGCCTGCTGTGGTGCTCCCCAGTGCAGCTCCTGCAGGGGCAGCAGCGCCCCC
CTCGGGGAGCAGGAGCACCAGTCCAAGCCCCTTGGAGGCCTGTCTGGAGGCTGAAGAGGC
CGGCTTGCCTCTGCAGGTCATCCTGACCCCGCCCGAGGCCCCAAACCTGAAATCGGAAGA
GCTTAATGTGGAGCCGGGTTTGGGCCGGGCTTTGCCCCCAGAAGTGAAAGTAGAAGGGCC
CAAGGAAGAGTTGGAAGTTGCGGGGGAGAGAGGGTTTGTGCCAGAAACCACCAAGGCCGA
GCCAGAAGTCCCTCCACAGGAGGGCGTGCCAGCCCGGCTGCCCGCGGTTGTTATGGACAC
CGCAGGGCAGGCGGGCGGCCATGCGGCTTCCAGCCCTGAGATCTCCCAGCCGCAGAAGGG
CCGGAAGCCCCGGGACCTAGAGCTTCCACTCAGCCCGAGCCTGCTAGGTGGGCCGGGACC
CGAACGGACCCCAGGATCGGGAAGTGGCTCCGGCCTCCAGGCTCCGGGGCCGGCGCTGAC
CCCATCCCTGCTTCCTACGCATACATTGACCCCGGTGCTGCTGACACCCAGCTCGCTGCC
TCCTAGCATTCACTTCTGGAGCACCCTGAGTCCCATTGCGCCCCGTAGCCCGGCCAAGCT
CTCCTTCCAGTTTCCATCCAGTGGCAGCGCCCAGGTGCACATCCCTTCTATCAGCGTGGA
TGGCCTCTCGACCCCCGTGGTGCTCTCCCCAGGGCCCCAGAAGCCATGACTACTACCACC
ACCACCACCACCCCTTCTGGGGTCACTCCATCCATGCTCTCTCCAGCCAGCCATCTCAAG
GAGAAACATAGTTCAACTGAAAGACTCATGCTCTGATTGTGGTGGGGTGGGGATCCTTGG
GAAGAATTACTCCCAAGAGTAACTCTCATTATCTCCTCCACAGAAAACACACAGCTTCCA
CAACTTCTCTGTTTTCTGTCAGTCCCCCAGTGGCCGCCCTTACACGTCTCCTACTTCAAT
GGTAGGGGCGGTTTATTTATTTATTTTTTGAAGGCCACTGGGAGGAGCCTGACCTAACCT
TTTAGGGTGGTTAGGACATCTCCCCCACCTCCCCACTTTTTTCCCCAAGACAAGACAATC
GAGGTCTGGCTTGAGAACGACCTTTCTTTCTTTATTTCTCAGCCTGCCCTTGGGGAGATG
AGGGAGCCCTGTCTGCGTTTTTGGATGTGAGTAGAAGAGTTAGTTTGTTTTGTTTTATTA
TTCCTGGCCATACTCAGGGGTCCAGGAAGAATTTGTACCATTTAATGGGTTGGGAGTCTT
GGCCAAGGAAGAATCACACCCTTGGAATAGAAATTTCCACCTCCCCAACCTTTCTCTCAG
ACAGCTTATCCTTTTCAACCAACTTTTTGGCCAGGGAGGAATGTCCCTTTTGTTCTTCCC
CCTGAGAAGCCATTCCTTTGTCTGCCAACCTCCCTGGGGTCCTGCCTGTTTCCTCCCAAT
GGAGGGTTTTTTTGGGGGGTGGTCCCCGTCTGGGGGGCCCCTCCAGCCAGTACTCCAGGT
CTCCCTGTCTCTCCCCCGCTGCCATTTTGATAGTATAATCTATTTTTAAATGGGGCTTTT
CAATAGGGGAGAGGGAGTCATCTCTTCCTATATTTGGTGGGGTGGGTGGGAAGGAAGGGA
TTTGGGGGGGAATCTTCCTGCCGCCTCCCCCACTCCAAGTGTTTATTTTTGATACCAAAC
ATGAATTTTCAGTTCCCTCCCTCCCAGCCCCCCAATTTCCTGCGGGCGGGTACAAAGGAC
CCTTTCAATGTCCCTGGAGTTGGGAGGGAGGAATGGGGGACATAAAGCCTGTCCTGTCTC
TATTCTAGGCAAGAGAGAGTGGGTTCAAAAGACTCCTGGGCTCACCTGTTAGCGCTGGCC
CAGCCCAGGCCTTGGGACCTGGGGGTTGGTGATTTGGGGGACAGTGCTACACTCGTCTCC
ACTGTTTGTTTTACTTCCCCAAAATGGACCTTTTTTTTTTCTAAAGAGTCCCAGAGAATG
GGGAATTGTTCCTGTAAATATATATTTTTCAAAGTGATAAAAAAAAAAAAAAAA

Protein Sequence

>2002 : length: 428
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKL
SRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIH
AAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSLQPQPPPHPRPAVV
LPSAAPAGAAAPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGL
GRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQAGGH
AASSPEISQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGSGSGLQAPGPALTPSLLPTH
TLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVV
LSPGPQKP