ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2000

Name

ELF4

Synonym

ELFR|MEF;E74-like factor 4 (ets domain transcription factor);ELF4;E74-like factor 4 (ets domain transcription factor)

Definition

ETS-related transcription factor Elf-4|myeloid Elf-1-like factor

Position

Xq26

Gene Type

protein-coding

Pathways and Diseases

Pathway

PDGF signaling pathway;PANTHER;P00047

Disease

Leukoencephalopathy;FunDO

External Links

Links to cell senescence gene database

2000

Links to epithelial mesenchymal transition gene database

2000

Links to ovarian cancer gene database

2000

Links to endometrial cancer gene database

2000

Links to iHOP

2000

Sequence Information

Nucleotide Sequence

>2000 : length: 4488
CCCAGCCCAGGCAAGGAGTCAGCCCCTTGCCACCCAACAACTGGAACCCTCCAGCCCCAC
CCTGTGTATTCTGGAGCCAGTGGGGTCCACCGTCTGGAGCTTAATGGGGCCCACAGCCCC
TGTTGCTCTCTGGGAGGTCACCTGAAACTCATCATCTGGATGAACGCTTTTTAATTTTCA
AAGTGCTTTTCCACTGCCATCTTTATTCACCCGAGACTCCCTGGTGAGCACCTGCTAAGC
CTGGATTACTCACAACCCTCACCTGCTCGAAGGATGACAGAAACCACAGCCCAGAAAGAT
GGCCGACTTTTCCATGGTCACACATCTTGCTAGGATGCAGCCAGAACGCCTCCCTCCTCC
TCCCCGGCCCTAGGCAGTCTACACTGTGGGTGGGCTGTGGGTCCCCTGGAGAAAGAGGAA
AAAGCATCTCTTTGCCTGGGACCTGCCATCTAATCACTCCTCCTCTGGGACAGATCAAGG
CCTGCAAAGAAGGTCGCTCCTGTGGTTGGTCCAGCCCAGAATGCAGCCTTGAGCCTGGCT
TAGGCCACCACCTACTCCAGCTCTCTCCACCCCCTATTTTACTGCAGCTCAGGGGGTAGG
CTCTAGGCTCCAAAGTACCTGGGTATTGTCCCTTCATCAAGAAAGCCCCACAGCTCTGGA
GGGCTCTGATAATCCCGTTGTCAGCTCTCTGAAAAGACAGCATGGCTATTACCCTACAGC
CCAGTGACCTGATCTTTGAGTTCGCAAGCAACGGGATGGATGATGATATCCACCAGCTGG
AAGACCCCTCTGTGTTCCCAGCTGTGATCGTGGAGCAGGTACCCTACCCTGATTTACTGC
ATCTGTACTCGGGACTGGAGTTGGACGACGTTCACAATGGCATCATAACAGACGGGACCT
TGTGCATGACGCAGGATCAGATCCTGGAAGGCAGTTTTTTGCTGACAGATGACAATGAGG
CCACCTCGCACACCATGTCAACCGCGGAAGTCTTACTCAATATGGAGTCTCCCAGCGATA
TCCTGGATGAGAAGCAGATCTTCAGTACCTCCGAAATGCTTCCAGACTCGGACCCTGCAC
CAGCTGTCACTCTGCCCAACTACCTGTTTCCTGCCTCTGAGCCCGATGCCCTGAACAGGG
CGGGTGACACTAGTGACCAGGAGGGGCATTCTCTGGAGGAGAAGGCCTCCAGAGAGGAAA
GTGCCAAGAAGACTGGGAAATCAAAGAAGAGAATCCGGAAGACCAAGGGCAACCGAAGTA
CCTCACCTGTCACTGACCCCAGCATCCCCATTAGGAAGAAATCAAAGGATGGCAAAGGCA
GCACCATCTATCTGTGGGAGTTCCTCCTGGCTCTTCTGCAAGACAGAAACACCTGTCCCA
AGTACATCAAGTGGACCCAGCGAGAGAAAGGCATCTTCAAACTGGTGGACTCCAAAGCTG
TGTCCAAGCTGTGGGGGAAGCAGAAAAACAAGCCTGACATGAACTATGAGACAATGGGGC
GGGCACTAAGATACTACTACCAAAGAGGCATACTGGCCAAAGTGGAAGGGCAGAGGCTGG
TGTACCAGTTTAAGGAGATGCCCAAGGACCTGGTGGTCATTGAAGATGAGGATGAGAGCA
GCGAAGCCACAGCAGCCCCACCTCAGGCCTCCACGGCCTCTGTGGCCTCTGCCAGTACCA
CCCGGCGAACCAGCTCCAGGGTCTCATCCAGATCTGCCCCCCAGGGCAAGGGCAGCTCTT
CTTGGGAGAAGCCAAAAATTCAGCATGTCGGTCTCCAGCCATCTGCGAGTCTGGAATTGG
GACCGTCGCTAGACGAGGAGATCCCCACTACCTCCACCATGCTCGTCTCTCCAGCAGAGG
GCCAGGTCAAGCTCACCAAAGCTGTGAGTGCATCTTCAGTGCCCAGCAACATCCACCTAG
GAGTGGCCCCCGTGGGGTCGGGCTCGGCCCTGACCCTGCAGACGATCCCACTGACCACGG
TGCTGACCAATGGGCCTCCTGCCAGTACTACTGCTCCCACTCAGCTCGTTCTCCAGAGTG
TTCCAGCGGCCTCTACTTTCAAGGACACCTTCACTTTGCAGGCCTCTTTCCCCCTGAACG
CCAGTTTCCAAGACAGCCAGGTGGCAGCCCCAGGGGCTCCACTGATTCTCAGTGGCCTCC
CCCAACTTCTGGCTGGGGCCAACCGTCCGACCAACCCGGCGCCACCCACGGTCACAGGGG
CTGGACCAGCAGGGCCCAGCTCTCAGCCCCCTGGGACTGTCATTGCTGCCTTCATCAGGA
CTTCTGGCACTACAGCAGCCCCTAGGGTCAAGGAGGGGCCACTGAGGTCCTCCTCCTATG
TTCAGGGTATGGTGACGGGGGCCCCCATGGAGGGGCTGCTGGTTCCTGAAGAGACCCTGA
GGGAGCTCCTGAGAGATCAGGCTCATCTTCAGCCACTTCCAACCCAGGTGGTTTCCAGGG
GTTCCCACAATCCGAGCCTTCTGGGCAACCAGACTTTGTCTCCTCCCAGCCGCCCCACTG
TTGGGCTGACCCCAGTGGCTGAACTTGAGCTCTCCTCAGGCTCAGGGTCCCTGCTGATGG
CTGAGCCTAGTGTGACCACATCTGGGAGCCTTCTGACAAGATCCCCCACCCCAGCCCCTT
TCTCCCCATTCAACCCTACTTCCCTCATTAAGATGGAGCCCCATGACATATAAGCAAAGG
GGTCAGGGCAAGTGTGACCCACCAGGCAAAATTGAGCAGCATTTTCATAGGGACCGACTT
CAGTAGCACACCTGCCCCTGCATTTCAGTGGGATGTCAATACACTTGACCCCAAGTCCCC
CGGCCCTGCCTGGTGTCACTGTGGCCAAACAGTGCCCAGCTTAAGCATCCCTGGCATCAG
ACTATGGCCTTCAAGAGCACTAGGGCATATGCTTTTGGCAGCATAACGGGCTGACTTGGT
GATGGAGGGAAAAAGCCTTGAGCCAGGCAGAAGTTTGTGGCCAGGGTTTGTGCAGCAGCT
TTGTGAGAAGAGCCCTTCTACCTGGCTCTATCTCACTGGCTGCATTCCCTACACAGGGAA
TTTACTACCCTATATGTGAATATCCCTGTATGTACTTGTGTGTACTTGTTGGTCTGTATC
TTAGTTTCTTTGGGGAGGACAGGGCTGTAGCTGTGAGGTCTTGTCTCCAAGGGTGTGTGT
ATGTCTCCGTGGATCAGCCACAGGGATAGGGATTTTGTTTTTAAGGGAAAGCATTCTCTA
ATTCCCTTTGTTCATGCCGAGATTCAGTTGCTCTGAGACTATGGGGTACAAGTTTGATCC
TCCGAATCTGGAGATGTTGTAGAGCTGGAACGAGTGCAGAGTAGGAACGCTTTGATGCGC
ATGCACATTGGGGAAGATGCGCTCCTCAGGGACACAAAGGCCGAGTGGGGTAAAACCACG
AAGGGAGGGAAGGGAAGTCAGCTCTGGGAGCAGCCCTCACTGGCTGGACCAAGGTACTCT
TCCTGGAGTTTGCCGTGTTAGCAACCACAGTCACCTTGCAGTCAGGCTGGAATCTTGGGC
CACCCCAAAGTGCTTTGCTGAAGGATTTAGACGGGGATGAAGTGCCCTCCAGCCTCAGAG
CTAGCCACAAAGCCCCCAGAGCTGAATTCATTGAGTATTTGTGCCTAGGGCTTGGGCTGT
TTGTGTGATACCGGCCCCCCGCCAGACAATAGCCTTTGCTGACACCCCAGCCTACTTCCC
CGATCCTGGGCTCCCTCTTGATTACTTTTTGACATTTTCCAGCTGTCAGGCATCACTGCG
GCTAGTCCGGCAGCGACCTAGATGGGGTCCACCCCCATTCCTGCTCAAGCATGGGCACCT
ACCACATGGTTTCTGCTGCTCAGCCTGCCTGCAACTCACCTCGAAGGCGGACCAGCCTGC
CTCTGTGATGACTGCAGCAGACCTCCTTGGGTGTACCAATGCCCCTCATCTCCCACTTTC
ACACCTAACCCTGACTCCTTCACCAAGAAGACGGGAGTCGGCAGCCAGGAGTTCCCGTGG
CACCTCTCTCTCTTCGTGGCTCCCTGCTTCCCCCTTCCCTCTTTCCGAGGAAGGGTCAAC
CTATTCTCTCTCAAAGCCAACCCCTAGGCCAATTGCCTGGATCTCCTCCCCTCTCCCTTC
TTTAAACGAGCTTGCCTCCCTCCTGCCAAGTTTGAGGGCAAGGCTAAGAAATGTCAGCCA
CGGAAACAACTCTATTATCTGGTGACTTTGGGTAATGTGAATCAGTGCCTGAGGACCTTT
GCTGTGTCCTTGGTACAGAACCATCCACTTGACCTAACTACCTCCCCTGGCCGCGCTCTC
GCTCTTCTCTTCTTTGTTAAGCCAACAACTATCACCCTCTCCTACTCTTCTTCTCCCTGC
CCCCTGGAGGGCACTGTGTTTGGTTGTGCAAATGTATTTACTATGCGTGTTTCCAGCAGT
TGGCATTAAAGTGCCTTTTTCTAATAAAATCAGTTTATTATGACAGTT

Protein Sequence

>2000 : length: 663
MAITLQPSDLIFEFASNGMDDDIHQLEDPSVFPAVIVEQVPYPDLLHLYSGLELDDVHNG
IITDGTLCMTQDQILEGSFLLTDDNEATSHTMSTAEVLLNMESPSDILDEKQIFSTSEML
PDSDPAPAVTLPNYLFPASEPDALNRAGDTSDQEGHSLEEKASREESAKKTGKSKKRIRK
TKGNRSTSPVTDPSIPIRKKSKDGKGSTIYLWEFLLALLQDRNTCPKYIKWTQREKGIFK
LVDSKAVSKLWGKQKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQFKEMPKDLVVI
EDEDESSEATAAPPQASTASVASASTTRRTSSRVSSRSAPQGKGSSSWEKPKIQHVGLQP
SASLELGPSLDEEIPTTSTMLVSPAEGQVKLTKAVSASSVPSNIHLGVAPVGSGSALTLQ
TIPLTTVLTNGPPASTTAPTQLVLQSVPAASTFKDTFTLQASFPLNASFQDSQVAAPGAP
LILSGLPQLLAGANRPTNPAPPTVTGAGPAGPSSQPPGTVIAAFIRTSGTTAAPRVKEGP
LRSSSYVQGMVTGAPMEGLLVPEETLRELLRDQAHLQPLPTQVVSRGSHNPSLLGNQTLS
PPSRPTVGLTPVAELELSSGSGSLLMAEPSVTTSGSLLTRSPTPAPFSPFNPTSLIKMEP
HDI