ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1994

Name

ELAVL1

Synonym

ELAV1|HUR|Hua|MelG;ELAV like RNA binding protein 1;ELAVL1;ELAV like RNA binding protein 1

Definition

ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R)|ELAV-like protein 1|Hu antigen R|embryonic lethal, abnormal vision, drosophila, homolog-like 1|hu-antigen R

Position

19p13.2

Gene Type

protein-coding

External Links

Links to cell senescence gene database

1994

Links to epithelial mesenchymal transition gene database

1994

Links to ovarian cancer gene database

1994

Links to endometrial cancer gene database

1994

Links to iHOP

1994

Sequence Information

Nucleotide Sequence

>1994 : length: 6075
GGTCGTGCGCGCTGAGGAGGAGCCGCTGCCGCCGTCGCCGTCGCCGCCACCGCCGCCACC
GCTACCGAGGCCGAGCGGAGCCGTTAGCGCCGCGCCGCCGCCGCCTCCCGCCCGCCCCGG
AGCAGCCCCGGGCCCGCCCGCCCGCATCCAGATTTTTGAAAAATACAATGTCTAATGGTT
ATGAAGACCACATGGCCGAAGACTGCAGGGGTGACATCGGGAGAACGAATTTGATCGTCA
ACTACCTCCCTCAGAACATGACCCAGGATGAGTTACGAAGCCTGTTCAGCAGCATTGGTG
AAGTTGAATCTGCAAAACTTATTCGGGATAAAGTAGCAGGACACAGCTTGGGCTATGGCT
TTGTGAACTACGTGACCGCGAAGGATGCAGAGAGAGCGATCAACACGCTGAACGGCTTGA
GGCTCCAGTCAAAAACCATTAAGGTGTCGTATGCTCGCCCGAGCTCAGAGGTGATCAAAG
ACGCCAACTTGTACATCAGCGGGCTCCCGCGGACCATGACCCAGAAGGACGTAGAAGACA
TGTTCTCTCGGTTTGGGCGGATCATCAACTCGCGGGTCCTCGTGGATCAGACTACAGGTT
TGTCCAGAGGGGTTGCGTTTATCCGGTTTGACAAACGGTCGGAGGCAGAAGAGGCAATTA
CCAGTTTCAATGGTCATAAACCCCCAGGTTCCTCTGAGCCCATCACAGTGAAGTTTGCAG
CCAACCCCAACCAGAACAAAAACGTGGCACTCCTCTCGCAGCTGTACCACTCGCCAGCGC
GACGGTTCGGAGGCCCCGTTCACCACCAGGCGCAGAGATTCAGGTTCTCCCCCATGGGCG
TCGATCACATGAGCGGGCTCTCTGGCGTCAACGTGCCAGGAAACGCCTCCTCCGGCTGGT
GCATTTTCATCTACAACCTGGGGCAGGATGCCGACGAGGGGATCCTCTGGCAGATGTTTG
GGCCGTTTGGTGCCGTCACCAATGTGAAAGTGATCCGCGACTTCAACACCAACAAGTGCA
AAGGGTTTGGCTTTGTGACCATGACAAACTATGAAGAAGCCGCGATGGCCATAGCCAGCC
TGAACGGCTACCGCCTGGGGGACAAAATCTTACAGGTTTCCTTCAAAACCAACAAGTCCC
ACAAATAACTCGCTCATGCTTTTTTTTGTACGGAATAGATAATTAAGAGTGAAGGAGTTG
AAACTTTTCTTGTTAGTGTACAACTCATTTTGCGCCAATTTTCACAAGTGTTTGTCTTTG
TCTGAATGAGAAGTGAGAAGGTTTTTATACTCTGGGATGCAACCGACATGTTCAAATGTT
TGAAATCCCACAATGTTAGACCAATCTTAAGTTTCGTAAGTTATTTCCTTTAAGATATAT
ATTAAACAGAAATCTAAGTAGAACTGCATTGACTAACCAGTCCCTCTGGATGGTGGTGAA
CCTGAAGCATGCTTTAACCTCTAAGACTGTCTAACACGCGTTTCATTCAATGTCTCCACA
GACTGGGTAGCAAAAAAATCACCTTTTAGTTTTAGTTTTTAATCTAAAGATGTTAGACAG
ATGCTGAGTGTGCGTTTTCTCAACCGCTTCAACATTGTAAGCGATGTATGCTTTGGTTGA
CAGGAAGTTCCTTTTCCAGGCAGGTCCCGTTGCCACCTCCTGCTCACTCAGTCCCGGGCT
CTGCCGAGTGGTCCTGGGAATGGCGGCGGGCCCGTCCAGCGTGGGCCACCACTGGGGCCG
GGGGCCACGGGCTGCATGCTGGGCGGGCCCTCCAGAGAAGGACACAAACGTGTTTCGTAA
GCCCAGGCACCAATGGGAATGGACCAAAGAGTTTCAGGGAAACTCCAGTATATTCCAGAG
TCAGATCTAAGCTCCAGGCACGCCTGAAGATGTGTTGCTACTCTGACATCCCGAGTTTCT
GTCCACACATTGCATGCACAGCGCCCCACACATTGGATACTGTTGTTCACGATAATTTCT
CCCGTTTTCCAGAGCATTTAACATAGCTTGGAGGCGTAAAATGGCTCTGTATTTTAATAA
CACAGAAACATTTGAGCATTGTATTTCTCGCATCCCTTCTCGTGAGCGCTTAGACCTTTT
TCTATTTTAGTCGGATTTTGTTTTGGAATTTTGCTTTTGTATGAACACTCAGCAGAAAAG
TACTTACTTCTTGCCAGTTATCTATTAACCAAAACCTTTGATTTGTAGTTTTAAAGATTA
ACCCTCAAAGTTCTCTTCATAACTGCCTTGACATTTTGGGTTGTTCTGTTCTGTTAATTT
TCTTTTGCTTTTTTGTGTTTTTTGTTTGTTTTTACTTTTGCATTTAAGACCATTAAATTT
GATTTTGTTTTGCTCGAATTTTGTTTTGTTTTTTATTTTACCTTTTCTTTCTTTTTGGCT
AGGGAAGGTGCAGGTGGCCCAGCATTCAGGGAGGAGTCGTAAGATCTTAAGAAACCAATC
CTTGCCTCAAGCAAAAGCATTTCTGAATCTGTGACGCAAGAATGTGCAGTTACAGGCTGG
TGGCTTTTAAACCAGGAGCCCGGAGGAAGGGTGAAAGAGAAAGCCTGTGAAATAGGCAGG
GCCAGATCACCCAAAACTCCTCAGGACTGGGATCTGGCGTTTATAAATAACTAGTTTACA
GAGAGAATCACAAACAGGATAACTTAGTACCAGCAGTTTTTAACCTTGACGTGAGACTAA
AACGTGACCGTAGGCTGTTTTTTAGTTATTGCTCTCATGAGATGATGGCTGTATTTATCT
GTTTATTTATACCTATTTATGTATTTATTTATTGAAGTGTGAAATTGAGCAATAGGCAGG
CACCACCGTCCCCAGAGCAGGTCAGCGTCTCGAGAGGCCCCTGGACAATTGAGGATGCCC
ATCCCCTCCCCTTTCCCTGATCTTTTACTGAGGGGCTGTGTGCGCGATCCTTGCAAATTG
ATGATGTTGCCATCCGTACCCAGGCTGTGTCTCATAAAAGTCGGCCTGGTGCCAGAGAGG
ACCTCCTTTCTCCCACAGAATCCCAGATCCTCAGGAAAAGCCAAAACCGAGGCCCATTGC
CCGGATTCGACACAAAAGAGGGTCCCTGCTCTGTTGCCCGAGAGCAGTCTGCATCCTGGG
ACCAGAATGCTTTCCTGGAAAAAGAAGCCTTTCAGGTTTCCCTGGGCCAGCATCTTCTGA
TGGAAGGTGGGAGCCAACACCCTTCTGATGGAAGGTGGGAGCCAACACCCTTCTGATGGA
AGGTGGGAGCCAACACCCTTCTGATGGAAGGTGGGAGCCAACACCCTTCTGATGGAAGGT
GGGAGCCAACACCCTTCTGATGGAAGGCGGGATTCCCGCTTCTGAAACTCCCCCTGGAGT
CTCACTCCCACACATGCCCATAGCTAGCATTCAACAGAGAACTCTGTCTTAAGCTTCAAC
TGTGAAAATGATGACGGGCTTGTAGCACCTCAGCTTCTTTCCTCGCCCCCTTTTATCTGA
ATCCTATCAATTATTCTGATGCTGGGACAGGTGAGAAGAAACTGTGAAGTATATGAGCCT
TTGAAAGTTCCCTGAAGTTTCTCAGTTCAGGAACATTCTCATTGTATGTGGTCTCCGCTG
TTTGAACAGCCTTCTAGCTAAAAAATTCCAAAGCCTTTATTTGGGAGTCTTAGCTTGCAA
GCTTGTGGAAGGATTTAGCTTAACAACTGTCACTCCTGAAAAGCAATCTCTGTTCCATCA
AGGTTCTAGTTGCTGGCCCTGTGTCCTCAAAGTTCATTACATCTTATCAAGGCCTGTTTG
CAAAGGGGAGATCCCTTTTCTTAAAAAAGGCTCAACCCAAAAGAAACCATTTCTTAAAAA
ATTTTACATAGATCAGTTGTATTTCTATTTAGCAAAAATGAGTGCTCTGCTTTTATTTGG
GAATTTCGATGAAAAAGCGTTCAGAGTAGATAATGTTCATTTATCAAAAATCTGGTTTGG
GAAATACCAAAGAGGCTTTGATTGAATTCCCTTTTGACCCGTGTGTAACTTCCTCTGGTA
GTTAGACCCCAGGCAGCTCCGAATTTGTGAACCTGCTTCCTGATGAATTCTCCCTTGTTC
CCCCTTGGCTCTGCCATTATTTCGTTTTCAGTGTAATTTGCCAAGCCGCAGTTTTCTGTG
CTGGCTGTGCCTCTAGTCGCAGCTCTGTGACTGATTCCCTCCCGGGTGCTGAGTCCCCTC
CCCGGCCACCATCCTGCGTGAATATCCTGAAATTCATGGGCTTCCTCGGGGGCCCGCCCG
CAGGTGGTGCTGGGTGGGTTCCGCCACCTTCTCCTGGAAGGTGAGCCTTTTCCTGGCCAA
GGGCAGCTGCCTTAACCTCTGAGAGTCTGCGCTTGGCCTTAGTCCTGGAGACCCAGCCTC
CAGGGACTGAACCGTGCTGCTGTTGGGAGCCAAGACCGGCCCTTTGGAGCCGGCAGCCCA
GGGGTCCCTGCTGGATCAGAGAAATAGAAGCACCCGAAGACGGTTAGTGGCAATTCCTTG
ACCCGGTTTGCTTCCAAATGAAGGCCATTTGTCCACCAGGCATTGAAAAGACATGACTTA
CCCAGTCCGGCATCGGACTTGAAAAATCGAAATTGACATCACTCAGCTGTTACATTTCAC
ATCCGATTCAGCCCCCTTTTATTTCCATGTGCTTTTCGCAGCCTTCCTGTGTTGGATGAA
AGAGAATAAGAATTCAGCTGACAGGAGGCCTCTATCCTGTCCCTCCACCCCACCCTCCAC
CTCAATCCCCTCCCATCTTCCCCAGACCTACCTCACCTACTAGGACCTGAGGCAGCTCCT
TAGCAGAGACCCCTGGGGTTTAGCTGACTCTGGGGGTCAGGGGTTCCTGTCCCCAAACTT
CGCAAGACAGCCCTGAAGTCACAAGTGCTTTCTTTTAAGTGGCATTGGCAATTGGCGTGT
AATGATGGCAGTAGAATCTGAATCTCGGATCCCAGGCAGGGTTCACATTTCCAAACCTTT
TTGATTTCCCCTGACCTCTAATGGCTGGATCCTATTTTTCTACAACCTTTCAGTGACATC
GTTCAGGTTTCTTTCTTGGCCATTTAAAAAAACAAATTTTTTTTTTCTCACTTGTAAGTC
ACCGCCAGTACCTAAGTTAGGCTAACGGAGACTTTGACAGGACTGGATTTTTCTTCCACC
AGAAGAGAAGCCTTTTCCGTTGGTTTGGGGCCACCTCTTTGACCATGACCATGTGATGTT
CCGTTTACAGTGACTTGCTTTGGGGGAGGGGAGGCTCTCTTAACCGATTCCCATGTTGTA
CAGTAGATGGTTAGACCTTTTGTATATTAGTGTGTTTTAAGTTATTGATTTGTTTTATAT
AAAATAATTTATTTTTCAGGTGCCATTTTTCATTTTAACTTTGTTTTTACATGGGTTTGT
TTTCAATAAAGTCTGACACTGGTGTCCAAAAGTCAACAATAAAATGAATCCCATTGTGTT
CTTTTGAAGATGCCTATGTAACTTTTAAGCTTTTTAAATTATTTTCAGAAAAAAAAAAAG
AAAAGCCCTTATCAGTTTTCCATCAGCCCATTGCCTTTTTATTTTTTTTTTTTAATCCTT
GTGAATAAATGTTCTTTAGTGTTTTAGGAGGAAAAAGCAAACCTAGATTTTGATAACCCA
GAAGACTTCAGATTAATAAAGAAGCTTTGAAAGAAGACCATTTTTCAAAATTTTAGTGAA
GTGTGAATATTTTTTGTCAATGGCTTTCTCAAAGAGAATGAAACTTTTGCACCATTTTCA
GAGTTTTTATAGAGATGCCAAATTGATATATTTACATGTAATGGAAACATGAAAAAGTTT
TATTAAACAATTGTTCATAGCTGTGTAGACATTTTAATTCAGTTTCCAAAGCTCTCAAAA
AATCGTATTTTTGAAGTACGGAGTGATGCGGTTTGGGGCGTGGCTTACAGTTCCAACGAC
TCAATTGTCCCGATACTCAGTTCTTTCTACAGGTATCAGGTTCGTGTTAAACGCTGTATG
TTAACTATGACTGGAATTCTGTGATATTTTGGTAATAAATGAAGTGGGATCATTGCGAAA
AAAAAAAAAAAAAAA

Protein Sequence

>1994 : length: 353
MGSGGRSAQVSTGQRAWLLPCRFLKNTMSNGYEDHMAEDCRGDIGRTNLIVNYLPQNMTQ
DELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERAINTLNGLRLQSKTIKV
SYARPSSEVIKDANLYISGLPRTMTQKDVEDMFSRFGRIINSRVLVDQTTGLSRGVAFIR
FDKRSEAEEAITSFNGHKPPGSSEPITVKFAANPNQNKNVALLSQLYHSPARRFGGPVHH
QAQRFRFSPMGVDHMSGLSGVNVPGNASSGWCIFIYNLGQDADEGILWQMFGPFGAVTNV
KVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVSFKTNKSHK