ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1977

Name

EIF4E

Synonym

AUTS19|CBP|EIF4E1|EIF4EL1|EIF4F;eukaryotic translation initiation factor 4E;EIF4E;eukaryotic translation initiation factor 4E

Definition

eIF-4E|eIF-4F 25 kDa subunit|eukaryotic translation initiation factor 4E-like 1|mRNA cap-binding protein

Position

4q23

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling by Insulin receptor;Reactome;REACT:498

Pathway

Transport of Mature Transcript to Cytoplasm;PID Reactome;500657

Pathway

Transport of Mature mRNA derived from an Intron-Containing Transcript;PID Reactome;500928

Pathway

Transport of Mature mRNA Derived from an Intronless Transcript;PID Reactome;500862

Pathway

Release of eIF4E;PID Reactome;500965

Pathway

Metabolism of RNA;Reactome;REACT:21257

Pathway

Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032

Pathway

3' -UTR-mediated translational regulation;Reactome;REACT:1762

Pathway

eukaryotic protein translation;PID BioCarta;100177

Pathway

Transport of the SLBP Dependant Mature mRNA;PID Reactome;500899

Pathway

Signaling mediated by p38-alpha and p38-beta;PID Curated;200154

Pathway

Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S;PID Reactome;500880

Pathway

Validated targets of C-MYC transcriptional activation;PID Curated;200045

Pathway

Gene Expression;Reactome;REACT:71

Pathway

GTP hydrolysis and joining of the 60S ribosomal subunit;PID Reactome;500970

Pathway

Insulin signaling pathway;KEGG PATHWAY;hsa04910

Pathway

internal ribosome entry pathway;PID BioCarta;100120

Pathway

Transport of Mature mRNAs Derived from Intronless Transcripts;PID Reactome;500658

Pathway

Metabolism of proteins;Reactome;REACT:17015

Pathway

mTOR signaling pathway;KEGG PATHWAY;hsa04150

Pathway

skeletal muscle hypertrophy is regulated via akt-mtor pathway;PID BioCarta;100137

Pathway

mTOR signaling pathway;PID Curated;200080

Pathway

Cap-dependent Translation Initiation;PID Reactome;500901

Pathway

Deadenylation of mRNA;PID Reactome;500855

Pathway

regulation of eif-4e and p70s6 kinase;PID BioCarta;100178

Pathway

mRNA Processing;Reactome;REACT:1675

Pathway

mtor signaling pathway;PID BioCarta;100101

Pathway

Transport of the SLBP independent Mature mRNA;PID Reactome;500879

Disease

Leukoencephalopathy;FunDO

Disease

Cancer;FunDO

Disease

Diabetes mellitus;FunDO

Disease

Adenovirus infection;FunDO

External Links

Links to cell senescence gene database

1977

Links to epithelial mesenchymal transition gene database

1977

Links to ovarian cancer gene database

1977

Links to endometrial cancer gene database

1977

Links to iHOP

1977

Sequence Information

Nucleotide Sequence

>1977 : length: 4842
GCACAGGCAGCCTGCATACACTCCTTTTCCTGGTGTCAACATTATTTAAAAGCATGGGAA
ATAGTAATGAGACAGTGTCTTCTTCATTAGAACCTTAGGAGTCTACTAGATTTCTTCATC
TCTATTTGTTGTTATTAGTAGCCAAACTGTGCAAAAAACACGGTCTTGAGAAATGACAGC
ACAGTATCTTAGAGGGAAAGGAAATGTAGGATGCCAGTGTGGGGACAAATTTCTGATTGC
CAGTGATTGTTGTGAGCATAACAATAATTTCATGAACATTAAAGCCTCTATTGAGGGCAG
CTGCAGTTGTAAAGGAAAAAAAATGGTCCTGAACATTTAAAACTACACTGGTGTACATCA
TAATCAAACAAAGTAAACAGAAAAAAATTTAAACTTTGCTAAAAAAAAAAAGCAGAAGCA
CTTGATCTTTAGGAAGGCACGCAGTTGCTTATTATGAATCATTTCTAGAGTCCGATGCAT
TTTCAAAGCCGGTTACAGTCATTACGAAGCACACCCTTGTGAGGTAAGTGTATCATCACC
TTTGGTTCATAAATAAAAAAGCTGAGACGCCGAGCGATTAAGTCACTCGCCTAAGGAGAA
TGAGTCAACGTCAAGAGTCATAGTTGACCCGGCCTAAAGACTCCAGACCATCAGTCCAGG
GCTTAGTCAGCGGGGCCCGGAGTGGCTTCCCTGGCTGGCATCTGGACTTAGGCTATTTCC
GTGCACGTAAAAGCGGAATATTGGAACGGTTGCACAGAACTTCCAAATAATTTTTACCGC
CACGCAAGATTTAGCCCTGAGGTCTTAATCTCAGGATTTGGGACAGTAAAAGCTGTCGTC
CCTCCCCCTCGTCCAGCCGGTGGCAAGCGGGTACTGCGGGCGGTTCCGTCCGTCCCCTTT
CGCAGAAATGGCAACGAATGACCACCAGCATTAGCTGAGCCAGGGGACGTGGGAGGGTTG
ATTGCCTAAACGACTCTGCATCGCCGCCTCTTTTTGAAACTAAGAGAAAATGGTGGGAGA
TCAAAAGAAAACTAAATAAACACACAGGCAACTTGTCCTGGGACCTCAACTAAGCAAATG
AAGCCTTATTGTGTGTGCTGAGCCTGCAGTTCCCAACCTTCCGGGGAAGATGGGAGGACA
GGGCGACAAAGGGCACAGTAGGCTTGCCTGGCAGTAAGTGTGACCGCAGCTATCCAGGCG
GAAGAGCAGAGGACTGAAACCACCCTCCAGCAAGCGAGTGTCCGCCGCGTTGAGAACCGC
GCACCCTACCCATCGGCCACGTGACCAGTCCTTTTTAAAAAAAATTTCTTTACCTTAAAA
AAAAAAAAAAAAAAAAGGTGGGGGAGAGACTCCACTTCCCAGAAGCCTCTCGTTACTCAC
GCAGCCGCAGTCTTGCGCAGGTGCCGCCAGGGCCAAACGGACATATCCGTCACGTGGCCA
GAAGCTGGCCAATCCGGTTTGAATCTCATTTTTTTCCTCTTACCCCCCCTTCTGGAGCGG
TTGTGCGATCAGATCGATCTAAGATGGCGACTGTCGAACCGGAAACCACCCCTACTCCTA
ATCCCCCGACTACAGAAGAGGAGAAAACGGAATCTAATCAGGAGGTTGCTAACCCAGAAC
ACTATATTAAACATCCCCTACAGAACAGATGGGCACTCTGGTTTTTTAAAAATGATAAAA
GCAAAACTTGGCAAGCAAACCTGCGGCTGATCTCCAAGTTTGATACTGTTGAAGACTTTT
GGGCTCTGTACAACCATATCCAGTTGTCTAGTAATTTAATGCCTGGCTGTGACTACTCAC
TTTTTAAGGATGGTATTGAGCCTATGTGGGAAGATGAGAAAAACAAACGGGGAGGACGAT
GGCTAATTACATTGAACAAACAGCAGAGACGAAGTGACCTCGATCGCTTTTGGCTAGAGA
CAAGATGGGATCTTGCTATGTTGCCCAGGTTGGTCTCAAACTTCTGGCCTCAAGTGATCC
TCCCACTTCAGCCTCCCAAAGTGCTGGAATTACAGCTTCTGTGCCTTATTGGAGAATCTT
TTGATGACTACAGTGATGATGTATGTGGCGCTGTTGTTAATGTTAGAGCTAAAGGTGATA
AGATAGCAATATGGACTACTGAATGTGAAAACAGAGAAGCTGTTACACATATAGGGAGGG
TATACAAGGAAAGGTTAGGACTTCCTCCAAAGATAGTGATTGGTTATCAGTCCCACGCAG
ACACAGCTACTAAGAGCGGCTCCACCACTAAAAATAGGTTTGTTGTTTAAGAAGACACCT
TCTGAGTATTCTCATAGGAGACTGCGTCAAGCAATCGAGATTTGGGAGCTGAACCAAAGC
CTCTTCAAAAAGCAGAGTGGACTGCATTTAAATTTGATTTCCATCTTAATGTTACTCAGA
TATAAGAGAAGTCTCATTCGCCTTTGTCTTGTACTTCTGTGTTCATTTTTTTTTTTTTTT
TTGGCTAGAGTTTCCACTATCCCAATCAAAGAATTACAGTACACATCCCCAGAATCCATA
AATGTGTTCCTGGCCCACTCTGTAATAGTTCAGTAGAATTACCATTAATTACATACAGAT
TTTACCTATCCACAATAGTCAGAAAACAACTTGGCATTTCTATACTTTACAGGAAAAAAA
ATTCTGTTGTTCCATTTTATGCAGAAGCATATTTTGCTGGTTTGAAAGATTATGATGCAT
ACAGTTTTCTAGCAATTTTCTTTGTTTCTTTTTACAGCATTGTCTTTGCTGTACTCTTGC
TGATGGCTGCTAGATTTTAATTTATTTGTTTCCCTACTTGATAATATTAGTGATTCTGAT
TTCAGTTTTTCATTTGTTTTGCTTTTGTTTTTTTCCTCATGTAACATTGGTGAAGGATCC
AGGAATATGACACAAAGGTGGAATAAACATTAATTTTGTGCATTCTTTGGTAATTTTTTT
TGTTTTTTGTAACTACAAAGCTTTGCTACAAATTTATGCATTTCATTCAAATCAGTGATC
TATGTTTGTGTGATTTCCTAAACATAATTGTGGATTATAAAAAATGTAACATCATAATTA
CATTCCTAACTAGAATTAGTATGTCTGTTTTTGTATCTTTATGCTGTATTTTAACACTTT
GTATTACTTAGGTTATTTTGCTTTGGTTAAAAATGGCTCAAGTAGAAAAGCAGTCCCATT
CATATTAAGACAGTGTACAAAACTGTAAATAAAATGTGTACAGTGAATTGTCTTTTAGAC
AACTAGATTTGTCCTTTTATTTCTCCATCTTTATAGAAGGAATTTGTACTTCTTATTGCA
AGGCAGTCTCTATATTATGTCTTCTTTTGTGGTGTCTTCCATGTGAACAGCATAAGTTTG
GAGCACTAGTTTGATTATTATGTTTATTACAATTTTTAATAAATTGAATAGGTAGTATCA
TATATATGGAATTAAATTGATGTGGCTATCTTTGTTTTTTTATAAAGTAAGGCACAGTCA
TTCAGTCTTAGGTAAATAATGTACTCTCTTAATATGTTAATACTCATGAGAATTGGGATC
TGATGCATCACCATTTGATTGGTAGCAACAGTGGTTGTAAAACTTGGTTGCTGAATTGAG
TTGTTTCTATGTTAAGTGTCAAAATGATAGTGTAGGGAAAGTACAGGTGGTGGGGACATA
TGCATTAAGAATCTTGTTAGTGTTGCAATCTAAATAGAATGGAATAAACAGGTGTTAAGA
CATATTTATAGTGGTAAATTGTTGTAGTATGGTATTCTGTAAACTTGAAAACTTGATCTA
CTCTTTGTAGGTATCATTTGAAAGCAAACTTGAAAATGTTTTGTACATAGTACATACTTG
TATAGTCCTGTGAGATGAAGTATGGCTATCAGACCAAAGGATAAGCCAAACTGTAGGTAG
CAGAATGGAAATTATTATTTTGAGAGGAAAATTTGTCTTTGAATGGTGATTATGACTTAA
TCATTTTAAAACTGATAAACTTGACAAAAACCCTGTATGAAATAAACATGAAATTAATAG
CACTGATTTCATTGTAAAATTTTAAAGCAGTTTAAAGGGTACCACAGGTTATCACAGTAC
TCTCAATGCCACAAACACCTCTTGTTCAGTATTCTAGAAATACTGAATCAGAATTCTGTG
TTTATTATAATCTCAGCATACTGTACATAATATCTGCTAGTTAAACTTGGGTAATTGGTT
AAGGTGACTTACTGTCTATGTCAATATGTATAGTTTTGAGTACTTCAAGAGTTTACTTAA
AAGTGATGATGTTACTGGTATGTTGGCAGTGGGTGGGACTGAAGTAGTGTATCTATTATA
AATTGATCTATTTTCTTAATTCTAAGATGAAGTCCAATTTTAAGCATCAGCTTTTAGGTG
CAAAGGAGGAATTAACACATTAAATGTATACAGTTCTAAATTTTTGAAATAACTGATGTG
TAGCATTTGATTATTGGTATTACCATTTTAGAATCATGATGTTATTTTAAACCTTTTTCC
TGGGGACAAGAAAGGATAATAAATTACGCTGAATCACTTTTGGCAGTTGCCACTTAAATA
GTACAGTGACTTGCAACTTTTATAACTTTATCAGCATCTTCTCTAAATACAAAATTAGGC
TATATGTTATTTTCCAACTTACTGTTTTCTCTCTGTTTAGCAGGATATTATAAATAGATT
AAATAGATATATTTTCTTTTTTTTTTTTTTTTTTTGAGACGGAGTCTCGCTTTGTCTCCC
AGGCTGGAGTGCAGTGGCGTGATCTCCCAGTAGCTGGGACTACAAGCACCTGCCACCATG
CCCGGCTAATTTTTTTTGTATTTTTAGTAGAGACGGGGTTTC

Protein Sequence

>1977 : length: 248
MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANL
RLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQ
QRRSDLDRFWLETRWDLAMLPRLVSNFWPQVILPLQPPKVLELQLLCLIGESFDDYSDDV
CGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGS
TTKNRFVV