ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1969

Name

EPHA2

Synonym

ARCC2|CTPA|CTPP1|CTRCT6|ECK;EPH receptor A2;EPHA2;EPH receptor A2

Definition

ephrin type-A receptor 2|epithelial cell receptor protein tyrosine kinase|soluble EPHA2 variant 1|tyrosine-protein kinase receptor ECK

Position

1p36

Gene Type

protein-coding

Pathways and Diseases

Pathway

EPHA2 forward signaling;PID Curated;200185

Pathway

EphrinA-EPHA pathway;PID Curated;200040

Pathway

Direct p53 effectors;PID Curated;200101

Pathway

Arf6 signaling events;PID Curated;200060

Pathway

Axon guidance;KEGG PATHWAY;hsa04360

Pathway

Stabilization and expansion of the E-cadherin adherens junction;PID Curated;200155

Pathway

EPHA forward signaling;PID Curated;200121

Disease

Drug abuse;FunDO

Disease

Cataract, posterior polar, 1;OMIM

Disease

VISION;GAD

Disease

Cancer;FunDO

Disease

Cataract;GAD

External Links

Links to cell senescence gene database

1969

Links to epithelial mesenchymal transition gene database

1969

Links to ovarian cancer gene database

1969

Links to endometrial cancer gene database

1969

Links to iHOP

1969

Sequence Information

Nucleotide Sequence

>1969 : length: 3970
GGTTCTCACCCAACTTCCATTAAGGACTCGGGGCAGGAGGGGCAGAAGTTGCGCGCAGGC
CGGCGGGCGGGAGCGGACACCGAGGCCGGCGTGCAGGCGTGCGGGTGTGCGGGAGCCGGG
CTCGGGGGGATCGGACCGAGAGCGAGAAGCGCGGCATGGAGCTCCAGGCAGCCCGCGCCT
GCTTCGCCCTGCTGTGGGGCTGTGCGCTGGCCGCGGCCGCGGCGGCGCAGGGCAAGGAAG
TGGTACTGCTGGACTTTGCTGCAGCTGGAGGGGAGCTCGGCTGGCTCACACACCCGTATG
GCAAAGGGTGGGACCTGATGCAGAACATCATGAATGACATGCCGATCTACATGTACTCCG
TGTGCAACGTGATGTCTGGCGACCAGGACAACTGGCTCCGCACCAACTGGGTGTACCGAG
GAGAGGCTGAGCGTATCTTCATTGAGCTCAAGTTTACTGTACGTGACTGCAACAGCTTCC
CTGGTGGCGCCAGCTCCTGCAAGGAGACTTTCAACCTCTACTATGCCGAGTCGGACCTGG
ACTACGGCACCAACTTCCAGAAGCGCCTGTTCACCAAGATTGACACCATTGCGCCCGATG
AGATCACCGTCAGCAGCGACTTCGAGGCACGCCACGTGAAGCTGAACGTGGAGGAGCGCT
CCGTGGGGCCGCTCACCCGCAAAGGCTTCTACCTGGCCTTCCAGGATATCGGTGCCTGTG
TGGCGCTGCTCTCCGTCCGTGTCTACTACAAGAAGTGCCCCGAGCTGCTGCAGGGCCTGG
CCCACTTCCCTGAGACCATCGCCGGCTCTGATGCACCTTCCCTGGCCACTGTGGCCGGCA
CCTGTGTGGACCATGCCGTGGTGCCACCGGGGGGTGAAGAGCCCCGTATGCACTGTGCAG
TGGATGGCGAGTGGCTGGTGCCCATTGGGCAGTGCCTGTGCCAGGCAGGCTACGAGAAGG
TGGAGGATGCCTGCCAGGCCTGCTCGCCTGGATTTTTTAAGTTTGAGGCATCTGAGAGCC
CCTGCTTGGAGTGCCCTGAGCACACGCTGCCATCCCCTGAGGGTGCCACCTCCTGCGAGT
GTGAGGAAGGCTTCTTCCGGGCACCTCAGGACCCAGCGTCGATGCCTTGCACACGACCCC
CCTCCGCCCCACACTACCTCACAGCCGTGGGCATGGGTGCCAAGGTGGAGCTGCGCTGGA
CGCCCCCTCAGGACAGCGGGGGCCGCGAGGACATTGTCTACAGCGTCACCTGCGAACAGT
GCTGGCCCGAGTCTGGGGAATGCGGGCCGTGTGAGGCCAGTGTGCGCTACTCGGAGCCTC
CTCACGGACTGACCCGCACCAGTGTGACAGTGAGCGACCTGGAGCCCCACATGAACTACA
CCTTCACCGTGGAGGCCCGCAATGGCGTCTCAGGCCTGGTAACCAGCCGCAGCTTCCGTA
CTGCCAGTGTCAGCATCAACCAGACAGAGCCCCCCAAGGTGAGGCTGGAGGGCCGCAGCA
CCACCTCGCTTAGCGTCTCCTGGAGCATCCCCCCGCCGCAGCAGAGCCGAGTGTGGAAGT
ACGAGGTCACTTACCGCAAGAAGGGAGACTCCAACAGCTACAATGTGCGCCGCACCGAGG
GTTTCTCCGTGACCCTGGACGACCTGGCCCCAGACACCACCTACCTGGTCCAGGTGCAGG
CACTGACGCAGGAGGGCCAGGGGGCCGGCAGCAAGGTGCACGAATTCCAGACGCTGTCCC
CGGAGGGATCTGGCAACTTGGCGGTGATTGGCGGCGTGGCTGTCGGTGTGGTCCTGCTTC
TGGTGCTGGCAGGAGTTGGCTTCTTTATCCACCGCAGGAGGAAGAACCAGCGTGCCCGCC
AGTCCCCGGAGGACGTTTACTTCTCCAAGTCAGAACAACTGAAGCCCCTGAAGACATACG
TGGACCCCCACACATATGAGGACCCCAACCAGGCTGTGTTGAAGTTCACTACCGAGATCC
ATCCATCCTGTGTCACTCGGCAGAAGGTGATCGGAGCAGGAGAGTTTGGGGAGGTGTACA
AGGGCATGCTGAAGACATCCTCGGGGAAGAAGGAGGTGCCGGTGGCCATCAAGACGCTGA
AAGCCGGCTACACAGAGAAGCAGCGAGTGGACTTCCTCGGCGAGGCCGGCATCATGGGCC
AGTTCAGCCACCACAACATCATCCGCCTAGAGGGCGTCATCTCCAAATACAAGCCCATGA
TGATCATCACTGAGTACATGGAGAATGGGGCCCTGGACAAGTTCCTTCGGGAGAAGGATG
GCGAGTTCAGCGTGCTGCAGCTGGTGGGCATGCTGCGGGGCATCGCAGCTGGCATGAAGT
ACCTGGCCAACATGAACTATGTGCACCGTGACCTGGCTGCCCGCAACATCCTCGTCAACA
GCAACCTGGTCTGCAAGGTGTCTGACTTTGGCCTGTCCCGCGTGCTGGAGGACGACCCCG
AGGCCACCTACACCACCAGTGGCGGCAAGATCCCCATCCGCTGGACCGCCCCGGAGGCCA
TTTCCTACCGGAAGTTCACCTCTGCCAGCGACGTGTGGAGCTTTGGCATTGTCATGTGGG
AGGTGATGACCTATGGCGAGCGGCCCTACTGGGAGTTGTCCAACCACGAGGTGATGAAAG
CCATCAATGATGGCTTCCGGCTCCCCACACCCATGGACTGCCCCTCCGCCATCTACCAGC
TCATGATGCAGTGCTGGCAGCAGGAGCGTGCCCGCCGCCCCAAGTTCGCTGACATCGTCA
GCATCCTGGACAAGCTCATTCGTGCCCCTGACTCCCTCAAGACCCTGGCTGACTTTGACC
CCCGCGTGTCTATCCGGCTCCCCAGCACGAGCGGCTCGGAGGGGGTGCCCTTCCGCACGG
TGTCCGAGTGGCTGGAGTCCATCAAGATGCAGCAGTATACGGAGCACTTCATGGCGGCCG
GCTACACTGCCATCGAGAAGGTGGTGCAGATGACCAACGACGACATCAAGAGGATTGGGG
TGCGGCTGCCCGGCCACCAGAAGCGCATCGCCTACAGCCTGCTGGGACTCAAGGACCAGG
TGAACACTGTGGGGATCCCCATCTGAGCCTCGACAGGGCCTGGAGCCCCATCGGCCAAGA
ATACTTGAAGAAACAGAGTGGCCTCCCTGCTGTGCCATGCTGGGCCACTGGGGACTTTAT
TTATTTCTAGTTCTTTCCTCCCCCTGCAACTTCCGCTGAGGGGTCTCGGATGACACCCTG
GCCTGAACTGAGGAGATGACCAGGGATGCTGGGCTGGGCCCTCTTTCCCTGCGAGACGCA
CACAGCTGAGCACTTAGCAGGCACCGCCACGTCCCAGCATCCCTGGAGCAGGAGCCCCGC
CACAGCCTTCGGACAGACATATGGGATATTCCCAAGCCGACCTTCCCTCCGCCTTCTCCC
ACATGAGGCCATCTCAGGAGATGGAGGGCTTGGCCCAGCGCCAAGTAAACAGGGTACCTC
AAGCCCCATTTCCTCACACTAAGAGGGCAGACTGTGAACTTGACTGGGTGAGACCCAAAG
CGGTCCCTGTCCCTCTAGTGCCTTCTTTAGACCCTCGGGCCCCATCCTCATCCCTGACTG
GCCAAACCCTTGCTTTCCTGGGCCTTTGCAAGATGCTTGGTTGTGTTGAGGTTTTTAAAT
ATATATTTTGTACTTTGTGGAGAGAATGTGTGTGTGTGGCAGGGGGCCCCGCCAGGGCTG
GGGACAGAGGGTGTCAAACATTCGTGAGCTGGGGACTCAGGGACCGGTGCTGCAGGAGTG
TCCTGCCCATGCCCCAGTCGGCCCCATCTCTCATCCTTTTGGATAAGTTTCTATTCTGTC
AGTGTTAAAGATTTTGTTTTGTTGGACATTTTTTTCGAATCTTAATTTATTATTTTTTTT
ATATTTATTGTTAGAAAATGACTTATTTCTGCTCTGGAATAAAGTTGCAGATGATTCAAA
CCGAAAAAAA

Protein Sequence

>1969 : length: 976
MELQAARACFALLWGCALAAAAAAQGKEVVLLDFAAAGGELGWLTHPYGKGWDLMQNIMN
DMPIYMYSVCNVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKETFN
LYYAESDLDYGTNFQKRLFTKIDTIAPDEITVSSDFEARHVKLNVEERSVGPLTRKGFYL
AFQDIGACVALLSVRVYYKKCPELLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGG
EEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEASESPCLECPEHTLPS
PEGATSCECEEGFFRAPQDPASMPCTRPPSAPHYLTAVGMGAKVELRWTPPQDSGGREDI
VYSVTCEQCWPESGECGPCEASVRYSEPPHGLTRTSVTVSDLEPHMNYTFTVEARNGVSG
LVTSRSFRTASVSINQTEPPKVRLEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKKGDSN
SYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSPEGSGNLAVIGG
VAVGVVLLLVLAGVGFFIHRRRKNQRARQSPEDVYFSKSEQLKPLKTYVDPHTYEDPNQA
VLKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTSSGKKEVPVAIKTLKAGYTEKQRVDF
LGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGML
RGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTSGGKIP
IRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPM
DCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTSG
SEGVPFRTVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAY
SLLGLKDQVNTVGIPI