ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1917

Name

EEF1A2

Synonym

EEF1AL|EF-1-alpha-2|EF1A|HS1|STN|STNL;eukaryotic translation elongation factor 1 alpha 2;EEF1A2;eukaryotic translation elongation factor 1 alpha 2

Definition

elongation factor 1-alpha 2|eukaryotic elongation factor 1 A-2|statin-S1

Position

20q13.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

1917

Links to epithelial mesenchymal transition gene database

1917

Links to ovarian cancer gene database

1917

Links to endometrial cancer gene database

1917

Links to iHOP

1917

Sequence Information

Nucleotide Sequence

>1917 : length: 2022
GCCCCGCCCCCGCCCGCGGCGCGTTTCTCCCCCGCCTCCCGCGTCCGTCTTTGCAGCCCG
CGCCTCCCGCATCGCCTCGCGTCCCCGTGGCGCCCGCCCGCGCGCGTCCGCGCCCCGCCC
CCTCCCGCGCGGTTCCGCATTGGCGTGCTGCAGGGCGCGGTGCACTGCGCCGCCACCGTC
AATAGGTGGACCCCCTCCCGGAGATAAAACCGCCGGCGCCGGCGCCGCCAGTCCCTCTGG
CTGAGACCTCGGCTCCGGAATCACTGCAGCCCCCCTCGCCCTGAGCCAGAGCACCCCGGG
TCCCGCCAGCCCCTCACACTCCCAGCAAAATGGGCAAGGAGAAGACCCACATCAACATCG
TGGTCATCGGCCACGTGGACTCCGGAAAGTCCACCACCACGGGCCACCTCATCTACAAAT
GCGGAGGTATTGACAAAAGGACCATTGAGAAGTTCGAGAAGGAGGCGGCTGAGATGGGGA
AGGGATCCTTCAAGTATGCCTGGGTGCTGGACAAGCTGAAGGCGGAGCGTGAGCGCGGCA
TCACCATCGACATCTCCCTCTGGAAGTTCGAGACCACCAAGTACTACATCACCATCATCG
ATGCCCCCGGCCACCGCGACTTCATCAAGAACATGATCACGGGTACATCCCAGGCGGACT
GCGCAGTGCTGATCGTGGCGGCGGGCGTGGGCGAGTTCGAGGCGGGCATCTCCAAGAATG
GGCAGACGCGGGAGCATGCCCTGCTGGCCTACACGCTGGGTGTGAAGCAGCTCATCGTGG
GCGTGAACAAAATGGACTCCACAGAGCCGGCCTACAGCGAGAAGCGCTACGACGAGATCG
TCAAGGAAGTCAGCGCCTACATCAAGAAGATCGGCTACAACCCGGCCACCGTGCCCTTTG
TGCCCATCTCCGGCTGGCACGGTGACAACATGCTGGAGCCCTCCCCCAACATGCCGTGGT
TCAAGGGCTGGAAGGTGGAGCGTAAGGAGGGCAACGCAAGCGGCGTGTCCCTGCTGGAGG
CCCTGGACACCATCCTGCCCCCCACGCGCCCCACGGACAAGCCCCTGCGCCTGCCGCTGC
AGGACGTGTACAAGATTGGCGGCATTGGCACGGTGCCCGTGGGCCGGGTGGAGACCGGCA
TCCTGCGGCCGGGCATGGTGGTGACCTTTGCGCCAGTGAACATCACCACTGAGGTGAAGT
CAGTGGAGATGCACCACGAGGCTCTGAGCGAAGCTCTGCCCGGCGACAACGTCGGCTTCA
ATGTGAAGAACGTGTCGGTGAAGGACATCCGGCGGGGCAACGTGTGTGGGGACAGCAAGT
CTGACCCGCCGCAGGAGGCTGCTCAGTTCACCTCCCAGGTCATCATCCTGAACCACCCGG
GGCAGATTAGCGCCGGCTACTCCCCGGTCATCGACTGCCACACAGCCCACATCGCCTGCA
AGTTTGCGGAGCTGAAGGAGAAGATTGACCGGCGCTCTGGCAAGAAGCTGGAGGACAACC
CCAAGTCCCTGAAGTCTGGAGACGCGGCCATCGTGGAGATGGTGCCGGGAAAGCCCATGT
GTGTGGAGAGCTTCTCCCAGTACCCGCCTCTCGGCCGCTTCGCCGTGCGCGACATGAGGC
AGACGGTGGCCGTAGGCGTCATCAAGAACGTGGAGAAGAAGAGCGGCGGCGCCGGCAAGG
TCACCAAGTCGGCGCAGAAGGCGCAGAAGGCGGGCAAGTGAAGCGCGGGCGCCCGCGGCG
CGACCCTCCCCGGCGGCGCCGCGCTCCGAACCCCGGCCCGGCCCCCGCCCCGCCCCCGCC
CCGCGCGCCGCTCCGGCGCCCCGCACCCCCGCCAGGCGCATGTCTGCACCTCCGCTTGCC
AGAGGCCCTCGGTCAGCGACTGGATGCTCGCCATCAAGGTCCAGTGGAAGTTCTTCAAGA
GGAAAGGCGCCCCCGCCCCAGGCTTCCGCGCCCAGCGCTCGCCACGCTCAGTGCCCGTTT
TACCAATAAACTGAGCGACCCCAGAAAAAAAAAAAAAAAAAA

Protein Sequence

>1917 : length: 463
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL
DKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV
GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKK
IGYNPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDTILPPTR
PTDKPLRLPLQDVYKIGGIGTVPVGRVETGILRPGMVVTFAPVNITTEVKSVEMHHEALS
EALPGDNVGFNVKNVSVKDIRRGNVCGDSKSDPPQEAAQFTSQVIILNHPGQISAGYSPV
IDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKPMCVESFSQYPP
LGRFAVRDMRQTVAVGVIKNVEKKSGGAGKVTKSAQKAQKAGK