ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1915

Name

EEF1A1

Synonym

CCS-3|CCS3|EE1A1|EEF-1|EEF1A|EF-Tu|EF1A|GRAF-1EF|HNGC:16303|LENG7|PTI1|eEF1A-1;eukaryotic translation elongation factor 1 alpha 1;EEF1A1;eukaryotic translation elongation factor 1 alpha 1

Definition

CTCL tumor antigen|EF-1-alpha-1|EF1a-like protein|cervical cancer suppressor 3|elongation factor 1 alpha subunit|elongation factor 1-alpha 1|elongation factor Tu|eukaryotic elongation factor 1 A-1|eukaryotic translation elongation factor 1 alpha 1-like 14

Position

6q14.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

west nile virus;PID BioCarta;100001

Pathway

Metabolism of proteins;Reactome;REACT:17015

Pathway

Peptide chain elongation;PID Reactome;500528

Pathway

Gene Expression;Reactome;REACT:71

Pathway

Eukaryotic Translation Elongation;PID Reactome;500527

Disease

Liver cancer;FunDO

Disease

Mental retardation;FunDO

External Links

Links to cell senescence gene database

1915

Links to epithelial mesenchymal transition gene database

1915

Links to ovarian cancer gene database

1915

Links to endometrial cancer gene database

1915

Links to iHOP

1915

Sequence Information

Nucleotide Sequence

>1915 : length: 3528
CTTTTTCGCAACGGGTTTGCCGCCAGAACACAGGTGTCGTGAAAACTACCCCTAAAAGCC
AAAATGGGAAAGGAAAAGACTCATATCAACATTGTCGTCATTGGACACGTAGATTCGGGC
AAGTCCACCACTACTGGCCATCTGATCTATAAATGCGGTGGCATCGACAAAAGAACCATT
GAAAAATTTGAGAAGGAGGCTGCTGAGATGGGAAAGGGCTCCTTCAAGTATGCCTGGGTC
TTGGATAAACTGAAAGCTGAGCGTGAACGTGGTATCACCATTGATATCTCCTTGTGGAAA
TTTGAGACCAGCAAGTACTATGTGACTATCATTGATGCCCCAGGACACAGAGACTTTATC
AAAAACATGATTACAGGGACATCTCAGGCTGACTGTGCTGTCCTGATTGTTGCTGCTGGT
GTTGGTGAATTTGAAGCTGGTATCTCCAAGAATGGGCAGACCCGAGAGCATGCCCTTCTG
GCTTACACACTGGGTGTGAAACAACTAATTGTCGGTGTTAACAAAATGGATTCCACTGAG
CCACCCTACAGCCAGAAGAGATATGAGGAAATTGTTAAGGAAGTCAGCACTTACATTAAG
AAAATTGGCTACAACCCCGACACAGTAGCATTTGTGCCAATTTCTGGTTGGAATGGTGAC
AACATGCTGGAGCCAAGTGCTAACATGCCTTGGTTCAAGGGATGGAAAGTCACCCGTAAG
GATGGCAATGCCAGTGGAACCACGCTGCTTGAGGCTCTGGACTGCATCCTACCACCAACT
CGTCCAACTGACAAGCCCTTGCGCCTGCCTCTCCAGGATGTCTACAAAATTGGTGGTATT
GGTACTGTTCCTGTTGGCCGAGTGGAGACTGGTGTTCTCAAACCCGGTATGGTGGTCACC
TTTGCTCCAGTCAACGTTACAACGGAAGTAAAATCTGTCGAAATGCACCATGAAGCTTTG
AGTGAAGCTCTTCCTGGGGACAATGTGGGCTTCAATGTCAAGAATGTGTCTGTCAAGGAT
GTTCGTCGTGGCAACGTTGCTGGTGACAGCAAAAATGACCCACCAATGGAAGCAGCTGGC
TTCACTGCTCAGGTGATTATCCTGAACCATCCAGGCCAAATAAGCGCCGGCTATGCCCCT
GTATTGGATTGCCACACGGCTCACATTGCATGCAAGTTTGCTGAGCTGAAGGAAAAGATT
GATCGCCGTTCTGGTAAAAAGCTGGAAGATGGCCCTAAATTCTTGAAGTCTGGTGATGCT
GCCATTGTTGATATGGTTCCTGGCAAGCCCATGTGTGTTGAGAGCTTCTCAGACTATCCA
CCTTTGGGTCGCTTTGCTGTTCGTGATATGAGACAGACAGTTGCGGTGGGTGTCATCAAA
GCAGTGGACAAGAAGGCTGCTGGAGCTGGCAAGGTCACCAAGTCTGCCCAGAAAGCTCAG
AAGGCTAAATGAATATTATCCCTAATACCTGCCACCCCACTCTTAATCAGTGGTGGAAGA
ACGGTCTCAGAACTGTTTGTTTCAATTGGCCATTTAAGTTTAGTAGTAAAAGACTGGTTA
ATGATAACAATGCATCGTAAAACCTTCAGAAGGAAAGGAGAATGTTTTGTGGACCACTTT
GGTTTTCTTTTTTGCGTGTGGCAGTTTTAAGTTATTAGTTTTTAAAATCAGTACTTTTTA
ATGGAAACAACTTGACCAAAAATTTGTCACAGAATTTTGAGACCCATTAAAAAAGTTAAA
TGAGAAACCTGTGTGTTCCTTTGGTCAACACCGAGACATTTAGGTGAAAGACATCTAATT
CTGGTTTTACGAATCTGGAAACTTCTTGAAAATGTAATTCTTGAGTTAACACTTCTGGGT
GGAGAATAGGGTTGTTTTCCCCCCACATAATTGGAAGGGGAAGGAATATCATTTAAAGCT
ATGGGAGGGTTGCTTTGATTACAACACTGGAGAGAAATGCAGCATGTTGCTGATTGCCTG
TCACTAAAACAGGCCAAAAACTGAGTCCTTGTGTTGCATAGAAAGCTTCATGTTGCTAAA
CCAATGTTAAGTGAATCTTTGGAAACAAAATGTTTCCAAATTACTGGGATGTGCATGTTG
AAACGTGGGTTAAAATGACTGGGCAGTGAAAGTTGACTATTTGCCATGACATAAGAAATA
AGTGTAGTGGCTAGTGTACACCCTATGAGTGGAAGGGTCCATTTTGAAGTCAGTGGAGTA
AGCTTTATGCCAGTTTGATGGTTTCACAAGTTCTATTGAGTGCTATTCAGAATAGGAACA
AGGTTCTAATAGAAAAAGATGGCAATTTGAAGTAGCTATAAAATTAGACTAATCTACATT
GCTTTTCTCCTGCAGAGTCTAATACCTTTTATGCTTTGATAATTAGCAGTTTGTCTACTT
GGTCACTAGGAATGAAACTACATGGTAATAGGCTTAACAGGTGTAATAGCCCACTTACTC
CTGAATCTTTAAGCATTTGTGCATTTGAAAAATGCTTTTCGCGATCTTCCTGCTGGGATT
ACAGGCATGAGCCACTGTGCCTGACCTCCCATATGTAAAAGTGTCTAAAGGTTTTTTTTT
GGTTATAAAAGGAAAATTTTTGCTTAAGTTTGAAGGATAGGTAAAATTAAAGGACATGCT
TTCTGTTTGTGTGATGGTTTTTAAAAATTTTTTTTAAGATGGAGTTCTTGTTGCCCAGGC
TAGAATGCAATGGCAAAATCTCACTGCAATCTCCTCCTCCTGGGTTCAAGCAATTCTCCT
ACTTCAGCCTCCCAAGTAGCTGGGATTACAGGCATGTGCTAATTTGGTGTTTTTAATAGA
GATGAGGTTTTTCCATGTTGGTCAGGCTGGTCTCAAACTCCTGACCTTAGGTGATCGCCT
CGGCCTCCTAAAGTGCTGGAATTACAGGCATGAGCCACCATGCCTGGCCAGGACATGTGT
TCTTAAGGACATGCTAAGCAGGAGTTAAAGCAGCCCAAGAGATAAGGCCTCTTAAAGTGA
CTGGCAATGTGTATTGCTCAAGATTCAAAGGTACTTGAATTGGCCATAGACAAGTCTGTA
ATGAAGTGTTATCGTTTTCCCTCATCTGAGTCTGAATTAGATAAAATGCCTTCCCATCAG
CCAGTGCTCTGAGGTATCAAGTCTAAATTGAACTAGAGATTTTTGTCCTTAGTTTCTTTG
CTATCTAATGTTTACACAAGTAAATAGTCTAAGATTTGCTGGATGACAGAAAAAACAGGT
AAGGCCTTTAATAGATGGCCAATAGATGCCCTGATAATGAAAGTTGACACCTGTAAGATT
TACCAGTAGAGAATTCTTGACATGCAAGGAAGCAAGATTTAACTGAAAAATTGTTCCCAC
TGGAAGCAGGAATGAGTCAGTTTACTTGCATATACTGAGATTGAGATTAACTTCCTGTGA
AACCCAGTGTCTTAGACAACTGTGGCTTGAGCACCACCTGCTGGTATTCATTACAAACTT
GCTCACTACAATAAATGAATTTTAAGCTTTAAAAAAAAAAAAAAAAAA

Protein Sequence

>1915 : length: 462
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL
DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV
GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKK
IGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTR
PTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALS
EALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPV
LDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPP
LGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK