ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1894

Name

ECT2

Synonym

ARHGEF31;epithelial cell transforming 2;ECT2;epithelial cell transforming 2

Definition

epithelial cell transforming sequence 2 oncogene|epithelial cell-transforming sequence 2 oncogene|protein ECT2

Position

3q26.1-q26.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling by Rho GTPases;Reactome;REACT:11044

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

PLK1 signaling events;PID Curated;200087

Pathway

Regulation of RhoA activity;PID Curated;200050

Disease

Cancer;FunDO

External Links

Links to cell senescence gene database

1894

Links to epithelial mesenchymal transition gene database

1894

Links to ovarian cancer gene database

1894

Links to endometrial cancer gene database

1894

Links to iHOP

1894

Sequence Information

Nucleotide Sequence

>1894 : length: 4764
GACTCCTGCCTATGGGAAAGAGGTTGACATCACGCGCCAATCGGCATGGCTCTTAGAGAG
AGCAGCTTAGTTTTTGAATCGGTTGTGGCGGCCGCCGGCGAGGAATGGCGGTATTTGTGA
GAGGAGTCGGCGTTTGAAGAGGTGGAACTCCTAGGGCTTTTTTGAGAGTGACGGAGTCTA
CCTCTTGTTACCTAGACTGGAGTGCAGTGGCACGATCTCGGCTCACTGCAACCTCTGCCT
CCCGGGTTCAAGCGATTCTCCTGCCTCAGCCTCCTGAGTAGCTGGGATTACAGGTGCCTG
CCACCAAGCCCAGCTAATTTTTGTATTTTTAGTAGAGACGGGGTTTCATTGTGTTGGCCA
GGCTGGTCTCGAACTCCTGACCTCGTGATCCGCCCGCCTTGGCCTCCCAAAGTGCTAGGA
TTACAAGTGTGAGCCACCGCGTCCGGCCTTTCAAATGGTATTTTTGATTTTCCTCTTCCA
GTCCTTAAAGCAGCTGATTTAGAAGAATACAAATCATGGCTGAAAATAGTGTATTAACAT
CCACTACTGGGAGGACTAGCTTGGCAGACTCTTCCATTTTTGATTCTAAAGTTACTGAGA
TTTCCAAGGAAAACTTACTTATTGGATCTACTTCATATGTAGAAGAAGAGATGCCTCAGA
TTGAAACAAGAGTGATATTGGTTCAAGAAGCTGGAAAACAAGAAGAACTTATAAAAGCCT
TAAAGACTATTAAAATAATGGAAGTCCCTGTTATAAAGATAAAAGAAAGTTGTCCTGGAA
AATCGGATGAAAAATTAATAAAAAGTGTTATTAATATGGACATTAAAGTGGGCTTTGTAA
AGATGGAGTCAGTGGAAGAATTTGAAGGTTTGGATTCTCCGGAATTTGAAAATGTATTTG
TAGTCACGGACTTTCAGGATTCTGTCTTTAATGACCTCTACAAGGCTGATTGTAGAGTTA
TTGGACCACCAGTTGTATTAAATTGTTCACAAAAAGGAGAGCCTTTGCCATTTTCATGTC
GCCCGTTGTATTGTACAAGTATGATGAATCTAGTACTATGCTTTACTGGATTTAGGAAAA
AAGAAGAACTAGTCAGGTTGGTGACATTGGTCCATCACATGGGTGGAGTTATTCGAAAAG
ACTTTAATTCAAAAGTTACACATTTGGTGGCAAATTGTACACAAGGAGAAAAATTCAGGG
TTGCTGTGAGTCTAGGTACTCCAATTATGAAGCCAGAATGGATTTATAAAGCTTGGGAAA
GGCGGAATGAACAGGATTTCTATGCAGCAGTTGATGACTTTAGAAATGAATTTAAAGTTC
CTCCATTTCAAGATTGTATTTTAAGTTTCCTGGGATTTTCAGATGAAGAGAAAACCAATA
TGGAAGAAATGACTGAAATGCAAGGAGGTAAATATTTACCGCTTGGAGATGAAAGATGCA
CTCACCTTGTAGTTGAAGAGAATATAGTAAAAGATCTTCCCTTTGAACCTTCAAAGAAAC
TTTATGTTGTCAAGCAAGAGTGGTTCTGGGGAAGCATTCAAATGGATGCCCGAGCTGGAG
AAACTATGTATTTATATGAAAAGGCAAATACTCCTGAGCTCAAGAAATCAGTGTCAATGC
TTTCTCTAAATACCCCTAACAGCAATCGCAAACGACGTCGTTTAAAAGAAACACTTGCTC
AGCTTTCAAGAGAGACAGACGTGTCACCATTTCCACCCCGTAAGCGCCCATCAGCTGAGC
ATTCCCTTTCCATAGGGTCACTCCTAGATATCTCCAACACACCAGAGTCTAGCATTAACT
ATGGAGACACCCCAAAGTCTTGTACTAAGTCTTCTAAAAGCTCCACTCCAGTTCCTTCAA
AGCAGTCAGCAAGGTGGCAAGTTGCAAAAGAGCTTTATCAAACTGAAAGTAATTATGTTA
ATATATTGGCAACAATTATTCAGTTATTTCAAGTACCATTGGAAGAGGAAGGACAACGTG
GTGGACCTATCCTTGCACCAGAGGAGATTAAGACTATTTTTGGTAGCATCCCAGATATCT
TTGATGTACACACTAAGATAAAGGATGATCTTGAAGACCTTATAGTTAATTGGGATGAGA
GCAAAAGCATTGGTGACATTTTTCTGAAATATTCAAAAGATTTGGTAAAAACCTACCCTC
CCTTTGTAAACTTCTTTGAAATGAGCAAGGAAACAATTATTAAATGTGAAAAACAGAAAC
CAAGATTTCATGCTTTTCTCAAGATAAACCAAGCAAAACCAGAATGTGGACGGCAGAGCC
TTGTTGAACTTCTTATCCGACCAGTACAGAGGTTACCCAGTGTTGCATTACTTTTAAATG
ATCTTAAGAAGCATACAGCTGATGAAAATCCAGACAAAAGCACTTTAGAAAAAGCTATTG
GATCACTGAAGGAAGTAATGACGCATATTAATGAGGATAAGAGAAAAACAGAAGCTCAAA
AGCAAATTTTTGATGTTGTTTATGAAGTAGATGGATGCCCAGCTAATCTTTTATCTTCTC
ACCGAAGCTTAGTACAGCGGGTTGAAACAATTTCTCTAGGTGAGCACCCCTGTGACAGAG
GAGAACAAGTAACTCTCTTCCTCTTCAATGATTGCCTAGAGATAGCAAGAAAACGGCACA
AGGTTATTGGCACTTTTAGGAGTCCTCATGGCCAAACCCGACCCCCAGCTTCTCTTAAGC
ATATTCACCTAATGCCTCTTTCTCAGATTAAGAAGGTATTGGACATAAGAGAGACAGAAG
ATTGCCATAATGCTTTTGCCTTGCTTGTGAGGCCACCAACAGAGCAGGCAAATGTGCTAC
TCAGTTTCCAGATGACATCAGATGAACTTCCAAAAGAAAACTGGCTAAAGATGCTGTGTC
GACATGTAGCTAACACCATTTGTAAAGCAGATGCTGAGAATCTTATTTATACTGCTGATC
CAGAATCCTTTGAAGTAAATACAAAAGATATGGACAGTACATTGAGTAGAGCATCAAGAG
CAATAAAAAAGACTTCAAAAAAGGTTACAAGAGCATTCTCTTTCTCCAAAACTCCAAAAA
GAGCTCTTCGAAGGGCTCTTATGACATCCCACGGCTCAGTGGAGGGAAGAAGTCCTTCCA
GCAATGATAAGCATGTAATGAGTCGTCTTTCTAGCACATCATCATTAGCAATTACCCATT
CTGTTTCCACAAGCAATGTAATTGGATTTACTAAGCATGTTTATGTTCAGCGCCTAAACT
CTACTGGTGGGCGCTCTCAGTACTCCTGGTTTCAATCTGTACGTCATTCTGCTTTCCGAG
CTAGTTTTTCAGAGATACTAGAAGGAAATACTGATTTTTCAAATTTCAAAAAAGTTCTTT
CCAAGTCATCTTTGACATTTGTGAAGAATTAGGAGATTTGCCAACCACTAATGGAAACAA
GCCTCATGAAGTTTAATGGTATCCCTTCTCCCTCCCTTGTCAGCCTTCCTTCCTTCTTTG
AAAGGAGAAGTCATACGTTAAGTAGATCTACAACTCATTTGATATGAAGCGTTACCAAAA
TCTTAAATTATAGAAATGTATAGACACCTCATACTCAAATAAGAAACTGACTTAAATGGT
ACTTGTAATTAGCACTTGGTGAAAGCTGGAAGGAAGATAAATAACACTAAACTATGCTAT
TTGATTTTTCTTCTTGAAAGAGTAAGGTTTACCTGTTACATTTTCAAGTTAATTCATGTA
AAAAATGATAGTGATTTTGATGTAATTTATCTCTTGTTTGAATCTGTCATTCAAAGGCCA
ATAATTTAAGTTGCTATCAGCTGATATTAGTAGCTTTGCAACCCTGATAGAGTAAATAAA
TTTTATGGGCGGGTGCCAAATACTGCTGTGAATCTATTTGTATAGTATCCATGAATGAAT
TTATGGAAATAGATATTTGTGCAGCTCAATTTATGCAGAGATTAAATGACATCATAATAC
TGGATGAAAACTTGCATAGAATTCTGATTAAATAGTGGGTCTGTTTCACATGTGCAGTTT
GAAGTATTTAAATAACCACTCCTTTCACAGTTTATTTTCTTCTCAAGCGTTTTCAAGATC
TAGCATGTGGATTTTAAAAGATTTGCCCTCATTAACAAGAATAACATTTAAAGGAGATTG
TTTCAAAATATTTTTGCAAATTGAGATAAGGACAGAAAGATTGAGAAACATTGTATATTT
TGCAAAAACAAGATGTTTGTAGCTGTTTCAGAGAGAGTACGGTATATTTATGGTAATTTT
ATCCACTAGCAAATCTTGATTTAGTTTGATAGTGTGTGGAATTTTATTTTGAAGGATAAG
ACCATGGGAAAATTGTGGTAAAGACTGTTTGTACCCTTCATGAAATAATTCTGAAGTTGC
CATCAGTTTTACTAATCTTCTGTGAAATGCATAGATATGCGCATGTTCAACTTTTTATTG
TGGTCTTATAATTAAATGTAAAATTGAAAATTCATTTGCTGTTTCAAAGTGTGATATCTT
TCACAATAGCCTTTTTATAGTCAGTAATTCAGAATAATCAAGTTCATATGGATAAATGCA
TTTTTATTTCCTATTTCTTTAGGGAGTGCTACAAATGTTTGTCACTTAAATTTCAAGTTT
CTGTTTTAATAGTTAACTGACTATAGATTGTTTTCTATGCCATGTATGTGCCACTTCTGA
GAGTAGTAAATGACTCTTTGCTACATTTTAAAAGCAATTGTATTAGTAAGAACTTTGTAA
ATAAATACCTAAAACCCAAGTGTA

Protein Sequence

>1894 : length: 958
MAENSVLTSTTGRTSLADSSIFDSKVTEISKENLLIGSTSYVEEEMPQIETRVILVQEAG
KQEELIKALKTIKIMEVPVIKIKESCPGKSDEKLIKSVINMDIKVGFVKMESVEEFEGLD
SPEFENVFVVTDFQDSVFNDLYKADCRVIGPPVVLNCSQKGEPLPFSCRPLYCTSMMNLV
LCFTGFRKKEELVRLVTLVHHMGGVIRKDFNSKVTHLVANCTQGEKFRVAVSLGTPIMKP
EWIYKAWERRNEQDFYAAVDDFRNEFKVPPFQDCILSFLGFSDEEKTNMEEMTEMQGGKY
LPLGDERCTHLVVEENIVKDLPFEPSKKLYVVKQEWFWGSIQMDARAGETMYLYEKANTP
ELKKSVSMLSLNTPNSNRKRRRLKETLAQLSRETDVSPFPPRKRPSAEHSLSIGSLLDIS
NTPESSINYGDTPKSCTKSSKSSTPVPSKQSARWQVAKELYQTESNYVNILATIIQLFQV
PLEEEGQRGGPILAPEEIKTIFGSIPDIFDVHTKIKDDLEDLIVNWDESKSIGDIFLKYS
KDLVKTYPPFVNFFEMSKETIIKCEKQKPRFHAFLKINQAKPECGRQSLVELLIRPVQRL
PSVALLLNDLKKHTADENPDKSTLEKAIGSLKEVMTHINEDKRKTEAQKQIFDVVYEVDG
CPANLLSSHRSLVQRVETISLGEHPCDRGEQVTLFLFNDCLEIARKRHKVIGTFRSPHGQ
TRPPASLKHIHLMPLSQIKKVLDIRETEDCHNAFALLVRPPTEQANVLLSFQMTSDELPK
ENWLKMLCRHVANTICKADAENLIYTADPESFEVNTKDMDSTLSRASRAIKKTSKKVTRA
FSFSKTPKRALRRALMTSHGSVEGRSPSSNDKHVMSRLSSTSSLAITHSVSTSNVIGFTK
HVYVQRLNSTGGRSQYSWFQSVRHSAFRASFSEILEGNTDFSNFKKVLSKSSLTFVKN