ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1892

Name

ECHS1

Synonym

ECHS1D|SCEH;enoyl CoA hydratase, short chain, 1, mitochondrial;ECHS1;enoyl CoA hydratase, short chain, 1, mitochondrial

Definition

enoyl Coenzyme A hydratase, short chain, 1, mitochondrial|enoyl-CoA hydratase, mitochondrial

Position

10q26.2-q26.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Fatty acid elongation in mitochondria;KEGG PATHWAY;hsa00062

Pathway

Valine, leucine and isoleucine degradation;KEGG PATHWAY;hsa00280

Pathway

fatty acid beta-oxidation I;BioCyc;FAO-PWY

Pathway

beta-Alanine metabolism;KEGG PATHWAY;hsa00410

Pathway

Metabolic pathways;KEGG PATHWAY;hsa01100

Pathway

tryptophan degradation III (eukaryotic);BioCyc;TRYPTOPHAN-DEGRADATION-1

Pathway

Butanoate metabolism;KEGG PATHWAY;hsa00650

Pathway

Metabolism of lipids and lipoproteins;Reactome;REACT:22258

Pathway

Propanoate metabolism;KEGG PATHWAY;hsa00640

Pathway

valine degradation I;BioCyc;VALDEG-PWY

Pathway

isoleucine degradation I;BioCyc;ILEUDEG-PWY

Pathway

Fatty acid metabolism;KEGG PATHWAY;hsa00071

Pathway

Lysine degradation;KEGG PATHWAY;hsa00310

Pathway

glutaryl-CoA degradation;BioCyc;PWY-5177

Pathway

Tryptophan metabolism;KEGG PATHWAY;hsa00380

Disease

Brain tumor;FunDO

External Links

Links to cell senescence gene database

1892

Links to epithelial mesenchymal transition gene database

1892

Links to ovarian cancer gene database

1892

Links to endometrial cancer gene database

1892

Links to iHOP

1892

Sequence Information

Nucleotide Sequence

>1892 : length: 1350
GCGGAGCGAGCCCTGAAAGGCTATAGGCGAGGGGGCGGCTCCGCGGGGCCGGGCGAGGAG
TCCAGAGAGCCATGGCCGCCCTGCGTGTCCTGCTGTCCTGCGTCCGCGGCCCGCTGAGGC
CCCCGGTTCGCTGTCCCGCCTGGCGTCCCTTCGCCTCGGGTGCTAACTTTGAGTACATCA
TCGCAGAAAAAAGAGGGAAGAATAACACCGTGGGGTTGATCCAACTGAACCGCCCCAAGG
CCCTCAATGCACTTTGCGATGGCCTGATTGACGAGCTCAACCAGGCCCTGAAGACCTTCG
AGGAGGACCCGGCCGTGGGGGCCATTGTCCTCACCGGCGGGGATAAGGCCTTTGCAGCTG
GAGCTGATATCAAGGAAATGCAGAACCTGAGTTTCCAGGACTGTTACTCCAGCAAGTTCT
TGAAGCACTGGGACCACCTCACCCAGGTCAAGAAGCCAGTCATCGCTGCTGTCAATGGCT
ATGCCTTTGGCGGGGGCTGTGAGCTTGCCATGATGTGTGATATCATCTATGCCGGTGAGA
AGGCCCAGTTTGCACAGCCGGAGATCTTAATAGGAACCATCCCAGGTGCGGGCGGCACCC
AGAGACTCACCCGTGCTGTTGGGAAGTCGCTGGCGATGGAGATGGTCCTCACTGGTGACC
GGATCTCAGCCCAGGACGCCAAGCAAGCAGGTCTTGTCAGCAAGATTTGTCCTGTTGAGA
CACTGGTGGAAGAAGCCATCCAGTGTGCAGAAAAAATTGCCAGCAATTCTAAAATTGTAG
TAGCGATGGCCAAAGAATCAGTGAATGCAGCTTTTGAAATGACATTAACAGAAGGAAGTA
AGTTGGAGAAGAAACTCTTTTATTCAACCTTTGCCACTGATGACCGGAAAGAAGGGATGA
CCGCGTTTGTGGAAAAGAGAAAGGCCAACTTCAAAGACCAGTGAGAACCAGCTGCCCCTG
CTTCACACCTCTGCTTGGAGAGGACAAGTGCAGCCTGTCAGTTTTAGAAGCAAGTAAATC
ATCCTCTTTTCAAGAGCAGTGTCCGTGGTGTGCAGTTCCTCTCCAATTGCTGCGTGGTCG
TGGCCCGACCTCTCACGGCATGACAGCCTTCGTCACCCAGCCTGTGAGGGTCCTGACTGG
AGCACCTTCTAAATCTAAGATTCTGCTGAGGAGCCCCCGCTGGTCCCTCTGGGCATGCTG
TGCTCGGACGGAAAGCGGGGCCTGCGGGTCCTTGTGTCCCTGCCGCTGAAGAATGGGGCT
GCTCTGAGGGAAACGCTGTCTGCTGCCTTCATACAGATGCTGATTAAAGTGATAGCGATT
CAGATTACAAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>1892 : length: 290
MAALRVLLSCVRGPLRPPVRCPAWRPFASGANFEYIIAEKRGKNNTVGLIQLNRPKALNA
LCDGLIDELNQALKTFEEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSSKFLKHW
DHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILIGTIPGAGGTQRLT
RAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIVVAMA
KESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ