ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1875

Name

E2F5

Synonym

E2F-5;E2F transcription factor 5, p130-binding;E2F5;E2F transcription factor 5, p130-binding

Definition

transcription factor E2F5

Position

8q21.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

TGF-beta signaling pathway;KEGG PATHWAY;hsa04350

Pathway

E2F transcription factor network;PID Curated;200027

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

Pathway

Cell cycle;KEGG PATHWAY;hsa04110

External Links

Links to cell senescence gene database

1875

Links to epithelial mesenchymal transition gene database

1875

Links to ovarian cancer gene database

1875

Links to endometrial cancer gene database

1875

Links to iHOP

1875

Sequence Information

Nucleotide Sequence

>1875 : length: 1743
GTGCGCGGGGGCCCGACCACCGCGGGGCCGGGACGCGATGGCGGCGGCAGAGCCCGCGAG
CTCGGGCCAGCAGGCGCCGGCAGGGCAGGGGCAGGGCCAGCGGCCGCCGCCGCAGCCTCC
GCAGGCGCAAGCCCCGCAGCCGCCCCCGCCGCCGCAGCTCGGGGGCGCCGGGGGCGGCAG
CAGCAGGCACGAGAAGAGCCTGGGGCTGCTCACTACCAAGTTCGTGTCGCTGCTGCAGGA
GGCCAAGGACGGCGTTCTGGATCTCAAAGCGGCTGCTGATACTTTGGCTGTGAGGCAAAA
AAGGAGAATTTATGATATCACCAATGTCTTAGAGGGAATTGACTTGATTGAAAAAAAGTC
AAAAAACAGTATCCAGTGGAAAGGTGTAGGTGCTGGCTGTAATACTAAAGAAGTCATAGA
TAGATTAAGATATCTTAAAGCTGAAATTGAAGATCTAGAACTGAAGGAAAGAGAACTTGA
TCAGCAGAAGTTGTGGCTACAGCAAAGCATCAAAAATGTGATGGACGATTCCATTAATAA
TAGATTTTCCTATGTAACTCATGAAGACATCTGTAATTGCTTTAATGGTGATACACTTTT
GGCCATTCAGGCACCTTCTGGTACACAACTGGAGGTACCCATTCCAGAAATGGGTCAGAA
TGGACAAAAGAAATACCAGATCAATCTAAAGAGTCATTCAGGACCTATCCATGTGCTGCT
TATAAATAAAGAGTCGAGTTCATCTAAGCCCGTGGTTTTTCCTGTTCCCCCACCTGATGA
CCTCACACAGCCTTCCTCCCAGTCCTTGACTCCAGTGACTCCACAGAAATCCAGCATGGC
AACTCAAAATCTGCCTGAGCAACATGTCTCTGAAAGAAGCCAGGCTCTGCAGCAGACATC
AGCTACAGATATATCTTCAGCAGGATCTATTAGTGGAGATATCATTGATGAGTTAATGTC
TTCTGACGTGTTTCCTCTCTTAAGGCTTTCTCCTACCCCGGCAGATGACTACAACTTTAA
TTTAGATGATAACGAAGGAGTTTGTGATCTGTTTGATGTCCAGATACTAAATTATTAGAT
TCCATGGAAACTTGGGACTGTTATCTACCTCTAACTGTGTAACATTTTAGACTTCTTAAT
AACCTAAATATTTAAAATAATGAATGTAACACCTTTTTTAGTTCACTGATTCTGAAGTGT
TCTTCCCTAATACTTTCTTTACTTCACAAAACTTCAACCATAAAAACAAAGGGCTCTGAT
TGCTTTAGGGGATAAGTGATTTAATATCCACAAACGTCCCCACTCCCAAAAGTAACTATA
TTCTGGATTTCAACTTTTCTTCTAATTGTGAATCCTTCTGTTTTTTCTTCTTAAGGAGGA
AAGTTAAAGGACACTACAGGTCATCAAAAACAAGTTGGCCAAGGACTCATTACTTGTCTT
ATATTTTTACTGCCACTAAACTGCCTGTATTTCTGTATGTCCTTCTATCCAAACAGACGT
TCACTGCCACTTGTAAAGTGAAGGATGTAAACGAGGATATATAACTGTTTCAGTGAACAG
ATTTTGTGAAGTGCCTTCTGTTTTAGCACTTTAAGTTTATCACATTTTGTTGACTTCTGA
CATTCCACTTTCCTAGGTTATAGGAAAGATCTGTTTATGTAGTTTGTTTTTAAAATGTGC
CAATGCCTGTACATTAACAAGATTTTTAAAAATAAAATTGTATAAAACATTCAAAAAAAA
AAA

Protein Sequence

>1875 : length: 346
MAAAEPASSGQQAPAGQGQGQRPPPQPPQAQAPQPPPPPQLGGAGGGSSRHEKSLGLLTT
KFVSLLQEAKDGVLDLKAAADTLAVRQKRRIYDITNVLEGIDLIEKKSKNSIQWKGVGAG
CNTKEVIDRLRYLKAEIEDLELKERELDQQKLWLQQSIKNVMDDSINNRFSYVTHEDICN
CFNGDTLLAIQAPSGTQLEVPIPEMGQNGQKKYQINLKSHSGPIHVLLINKESSSSKPVV
FPVPPPDDLTQPSSQSLTPVTPQKSSMATQNLPEQHVSERSQALQQTSATDISSAGSISG
DIIDELMSSDVFPLLRLSPTPADDYNFNLDDNEGVCDLFDVQILNY