ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1871

Name

E2F3

Synonym

E2F-3;E2F transcription factor 3;E2F3;E2F transcription factor 3

Definition

transcription factor E2F3

Position

6p22

Gene Type

protein-coding

Pathways and Diseases

Pathway

Pancreatic cancer;KEGG PATHWAY;hsa05212

Pathway

Melanoma;KEGG PATHWAY;hsa05218

Pathway

Glioma;KEGG PATHWAY;hsa05214

Pathway

Small cell lung cancer;KEGG PATHWAY;hsa05222

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

Validated targets of C-MYC transcriptional activation;PID Curated;200045

Pathway

E2F transcription factor network;PID Curated;200027

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

Pathway

Non-small cell lung cancer;KEGG PATHWAY;hsa05223

Pathway

Cell cycle;KEGG PATHWAY;hsa04110

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Bladder cancer;KEGG PATHWAY;hsa05219

Disease

Cancer;FunDO

External Links

Links to cell senescence gene database

1871

Links to epithelial mesenchymal transition gene database

1871

Links to ovarian cancer gene database

1871

Links to endometrial cancer gene database

1871

Links to iHOP

1871

Sequence Information

Nucleotide Sequence

>1871 : length: 5027
GCCATTTTTCAGCTGCCGGCCGCAGCACCCGGGCTGCCGCCGCCGCCTCGCAATCCGTTG
CATCGGCCGCCCCCGACGCCTCCATCCCCGCTTGGGGCCCGATATCCGTGCGGCCGGGAC
CCTCCTCTCTCCAGAGCCCCGATTATTTTTGGCCCCCGGGGCCTGTGCGGTGCGGAAAAA
TAAAAAGAAAAGAGAGAGAGGGGGCTCGGAAGCGCCGGGCGGGGAGGAGAGAAGGAGGAG
AGACTTGGAAACTCCGACTGCAAATAATAAAGAAATTGAAAACAATACATTAATATACCA
TAACACTAAAAAGAGCAGGAGCGAGAGATGAGAAAGGGAATCCAGCCCGCTCTGGAGCAG
TACCTGGTGACCGCCGGGGGTGGGGAGGGGGCGGCTGTCGTCGCCGCCGCCGCTGCAGCC
TCCATGGACAAAAGGGCACTGCTAGCCAGCCCCGGCTTCGCCGCCGCCGCCGCCGCTGCC
GCCGCCCCGGGCGCGTACATCCAGATCCTCACCACGAACACTTCCACCACCTCCTGTTCC
TCCTCCCTCCAAAGCGGCGCCGTAGCCGCCGGCCCCCTCCTCCCCAGTGCCCCCGGCGCG
GAGCAGACCGCCGGCAGCCTCCTCTACACCACGCCGCACGGACCCTCCAGCAGAGCCGGG
CTGCTGCAGCAGCCACCAGCGCTGGGACGCGGCGGCAGCGGCGGCGGCGGCGGCCCTCCG
GCAAAGCGAAGGCTGGAGCTAGGAGAAAGCGGTCATCAGTACCTCTCAGATGGTTTAAAA
ACCCCCAAGGGCAAAGGAAGAGCTGCACTACGAAGTCCAGATAGTCCAAAAACTCCAAAA
TCTCCCTCAGAAAAAACGCGGTATGATACGTCTCTTGGTCTGCTCACCAAGAAGTTCATT
CAGCTCCTGAGCCAGTCACCCGATGGGGTATTGGATTTGAACAAGGCAGCAGAAGTGCTA
AAAGTGCAAAAGAGAAGGATTTATGATATCACCAACGTTCTGGAAGGCATCCACCTCATT
AAGAAGAAGTCTAAAAACAACGTCCAATGGATGGGCTGCAGTCTGTCTGAGGATGGGGGC
ATGCTGGCCCAGTGTCAAGGCCTGTCAAAAGAAGTGACCGAGCTCAGTCAGGAAGAGAAG
AAATTAGATGAACTGATCCAAAGCTGCACCCTGGACCTCAAACTGTTAACCGAGGATTCA
GAGAATCAAAGGTTAGCTTATGTTACATATCAAGATATTCGAAAAATTAGTGGCCTTAAA
GACCAAACTGTTATAGTTGTGAAAGCCCCTCCAGAAACAAGACTTGAAGTGCCTGACTCA
ATAGAGAGCCTACAAATACATTTGGCAAGTACCCAAGGGCCCATTGAGGTTTACTTATGT
CCAGAAGAGACTGAAACACACAGTCCAATGAAAACAAACAACCAAGACCACAATGGGAAT
ATCCCTAAACCCGCTTCCAAAGACTTGGCTTCAACCAACTCAGGACATAGCGATTGCTCA
GTTTCTATGGGAAACCTTTCTCCTCTGGCCTCCCCAGCCAACCTCTTACAGCAGACTGAG
GACCAAATTCCTTCCAACCTAGAAGGACCGTTTGTGAACTTACTGCCTCCCCTGCTGCAA
GAGGACTATCTCCTGAGCCTCGGGGAGGAGGAAGGCATCAGCGATCTCTTCGATGCTTAC
GATTTGGAAAAGCTCCCACTGGTGGAAGACTTCATGTGTAGTTGATTATGCTTCGTGTGA
ACTCTCCTTAAAAACCGATATTTTTTTATCATGGAACCAGAACATCTGTCATGCAGTGTT
GTCCCTTCCTACCTTCTTCCTCCAAGAGAGTATCATGAAGTAAACTACAAACTTCAGAAG
AAAGCTGACATTTTAATGAATTTTTTAAAAAATTAATAAACAAATTGTCTAAACGCACAG
TTGCAGGCTCCCTTGGGAAAGCCCTGCTTTGCTCCAGGCTCCAAGATCTCCTGGCTAAGT
CAGCAAGTGAGAAAATGTGCAATCAGGTGTCTCTCACCCCGAATTGTCCTTCCTCCTTCC
TCCCCGGATTGGCTTGCTGTGCCTGACGGATGGGCTGTAGAATGGGGTCTGGCCACCTGG
CCTGCTGGGAAACAGCAATCTTCCTTAATAGCATTTCAAGCCGTGCCTTCTCCGCAGAAT
GCATGTCTTTGAGGTCTGCTAATATGGAATGGAACTGCAGCAAATGCAAACTTGAAGTCA
TGCAAAAGTATGAAATGGATTTCTTCAGCTCTTCTTAGGAATATTTAAATTACTGTCATA
ATTCAGTTTAAGCTATGAACTGTGTGTCCCAGTAGGAGGTCAAGAAAACCTCCACAGCCT
TCTGGATGAAGAACCTGTTTTCAAATATACTTGTTGCAGATACAGAAGACTAGTAGAGTT
CTGCCACTCTAAGCTGTTGTGGATTTTCCTGTCTCCATGAACCACTCCCATTCCCCCGTC
CCCAATGTGTTTGTGAGTTTCCAGTTGATTTGTAGCAAATGCCTACTTAGTTCTTTGTGG
ATTGTTCTAGACTTTTAATTTTTTTAGCTGCCATTTAAGCATTCCTGTGGCACCCATCAC
CATTTCAATTTAATTGTTTACTTTGAAGCGGTTTTTGCAAATTCATATTACTTAAGCAGA
GGGAGAGAACCTCTACTGATCAGAGCATCTAAACCTGTGTGATCTAAGGTTTATCAGCCT
CTGCAAGGAGCTTTGTCCCATCGTGCTTCCATTCCCAGGAGGGGGAGCTTGGAGCGAGTC
AGTCCTGGGGCTTGCTGACATGGGTGGCCCATTGGAAAGGAGAACCAGGTCAGATGATGT
AACAGCCCCAAGGAGCAGCAGGCATGGGTCCCTCCATCCTTGGGCTTCCCGGGCCCCTGT
GACAGGGGAAAGGGCTCTCTTACACCGCACTCAGGGAGACCACTTCTCAGGATGGGGTCA
GATGGAGAGACCTCTAGGGAGAAAGACATCCCCATTGTGTGAGTGGCATTTCCTTAAGCT
GGCAGGAACAGGGAGCAGCCCTGTGTCGGGGGCTGGAATAGTTCTGGCCAGACCCCGTTC
CCCTTCCTCTATGAAGGAATAAGTTGGACCAAGGGAAGTCGGGGACGTAAAAAATGAAGC
AAAACAATGCCAGGGTGTCTCCCGCTTTACTCTTCAGGAATGGTGTCCCAAGTTGGAGGC
TTTGTGTCAGCTGCAAATCCTACCAGTTATGTCCAAGAATGGCTTTCCCTCGGGCAGGTG
GCAGCGGCCATCTCCCACTGGGAATATGGCGTAGTATCTCCGGTCCATTCCTTGGATGCT
AAGGACTGCGGGAATGAGGGAGTCAGATAAAGAACAAACCTCGAAACGAACAGTTAAATT
GAAATGCTATGTGCCTGACCCAATGGTAGGCACATAGTAGGCACTCAACTCATATGTTTA
ATTGAATTGAAAATATCCCTTAGGAAAAAAAAAAAACACACAAAAAACCACAAGAGCCCC
AGCCAGTTTACTCCAGGTAGATTTCCACAATATGCAAAGTGGTGGTGGGGTCAAGACAGA
TGACACCAGCACTTTAAACTCTTTGTGTGGGTATGCGTGGGTGTATGTTTGGGAAGAAAA
ACAAAGGTGCAGACTATCTTCCTTTTTTTCTTCTTCAGCCTCCATCCCTGGCCTCCTCCC
CTCACACACACTGGACTTGGTACAAAATGTCGGTGTGGTCCTAGATGAAGCATTGGGGTG
GGGGAGGGAGAGGGAGCTTTGTGTTAAGTGCCTACTGGAAATGCACTGTGGGGTTTTTTC
CTGTATGGGAAACCATTTATGCCAAGCTTTTCCCCATTTCCCATATTTATCTCATCTGGT
TAGCTGCCTCTGCTTCCAGCTTTGTGTAATTCTCTTTGCCAGCTGCACAAAGCTGATTTT
TTCCAAAGTCTAAAGACTGAGCTCACCTGGCTAGATTGTTGTGTGTTTTGTTGAATTTTT
TCATAATGTAATGCCGTATTTATTGTTTTTAAAATGAAAGGAATACTAATAAGTCTTAAA
AGTTCCTTCATGCATAAGATTTTTTTCCAGTTACTGGGTTTAACTGGTGTACATTAATTA
GATGTCCATACTGTATTTTGTTTGCATTAAGTAATTTTCTTTTTGACTTAGTATCCGGCA
CACAAAGTGGGTTAGTACTACAGTATTTGCGTTACTTTAAGTACTAAGTATGCAGGTTTC
CTGGTACCATTGAGTTGCTGCTATTAAAGCTCACACACGAAATGGCTAAAAGTTACAAGT
GTGCAAATTATGACTGCGTGAGCCTTAGAAAATAAAATGTATAAAGGGCAACACATGAGC
TGTCAAACAGTGTTAGGAGTGTGTTTATATGTACAGAGTTGTGCATAGCAATCGTTTTAT
TTAAGTTGATATGTAGTCTACTCACATTTTCATTATTTAGCAATTTTGTACAAAAATAGC
AATTAATTTGTAAACACTGCCAGAATACTTTCTAGCTGCTTTGTAATTTTTTAAGAGTGT
TATTTTGTTTTTGTTTTTCTGTTCTTTGTTGTGGCTCTTGTTTTCATTTTTGTTGTACGT
GTAGATCTGTAAATAAAATTGCAGTATTTAAAGCTTAAGCTTTCAGGAAAAAGAAAATAA
GAATTCAGTGTGTGCATGACAACTCGTGTGTATGAGAAGGAGGGATATGAAGGAAGATGG
CTTGCAGAGTAAGTCGGGTGGCAATTGTCAGGGTGTGGGAATTTCTTTTCCTACGGGGTA
CGTGATTTTGTAAAAAGGAAGTATTTCTCCCAAAATTGGGAGTAGGCAAACTACTAATCA
GTTTAGCTTTGTGTTGTATGCTAGTTTAAAAAAGAAAATATGTAATATAATGTAAAAAAA
AACAAAAAAAAGCTTTTATGATGGATTTTGTAAATAGATTTGTTACAGGGTGACCTGTTC
TCTAGCTGTGATCTTACCACTTCAAATGGGTGTAATTTGAATAAATTTTGTATGGTAAAG
GATCAATAAAATGATTTTTTTTAAGAGTTAAAAAAAAAAAAAAAAAA

Protein Sequence

>1871 : length: 465
MRKGIQPALEQYLVTAGGGEGAAVVAAAAAASMDKRALLASPGFAAAAAAAAAPGAYIQI
LTTNTSTTSCSSSLQSGAVAAGPLLPSAPGAEQTAGSLLYTTPHGPSSRAGLLQQPPALG
RGGSGGGGGPPAKRRLELGESGHQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYD
TSLGLLTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQ
WMGCSLSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVT
YQDIRKISGLKDQTVIVVKAPPETRLEVPDSIESLQIHLASTQGPIEVYLCPEETETHSP
MKTNNQDHNGNIPKPASKDLASTNSGHSDCSVSMGNLSPLASPANLLQQTEDQIPSNLEG
PFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS