ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1869

Name

E2F1

Synonym

E2F-1|RBAP1|RBBP3|RBP3;E2F transcription factor 1;E2F1;E2F transcription factor 1

Definition

PBR3|PRB-binding protein E2F-1|RBAP-1|RBBP-3|retinoblastoma-associated protein 1|retinoblastoma-binding protein 3|transcription factor E2F1

Position

20q11.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

influence of ras and rho proteins on g1 to s transition;PID BioCarta;100054

Pathway

il-2 receptor beta chain in t cell activation;PID BioCarta;100129

Pathway

Non-small cell lung cancer;KEGG PATHWAY;hsa05223

Pathway

Small cell lung cancer;KEGG PATHWAY;hsa05222

Pathway

cell cycle: g1/s check point;PID BioCarta;100160

Pathway

p75(NTR)-mediated signaling;PID Curated;200103

Pathway

Pancreatic cancer;KEGG PATHWAY;hsa05212

Pathway

Regulation of Telomerase;PID Curated;200072

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

e2f1 destruction pathway;PID BioCarta;100034

Pathway

tumor suppressor arf inhibits ribosomal biogenesis;PID BioCarta;100237

Pathway

Notch-mediated HES/HEY network;PID Curated;200196

Pathway

rb tumor suppressor/checkpoint signaling in response to dna damage;PID BioCarta;100046

Pathway

E2F transcription factor network;PID Curated;200027

Pathway

mets affect on macrophage differentiation;PID BioCarta;100169

Pathway

Calcineurin-regulated NFAT-dependent transcription in lymphocytes;PID Curated;200039

Pathway

p53 signaling pathway;PID BioCarta;100083

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

Pathway

cyclin e destruction pathway;PID BioCarta;100166

Pathway

Cell cycle;KEGG PATHWAY;hsa04110

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Bladder cancer;KEGG PATHWAY;hsa05219

Pathway

Melanoma;KEGG PATHWAY;hsa05218

Pathway

Glioma;KEGG PATHWAY;hsa05214

Pathway

cyclins and cell cycle regulation;PID BioCarta;100207

Pathway

IL2 signaling events mediated by PI3K;PID Curated;200099

Pathway

regulation of p27 phosphorylation during cell cycle progression;PID BioCarta;100087

Disease

Lung carcinomas;GAD

Disease

CANCER;GAD

Disease

Cancer;FunDO

Disease

HIV infection;FunDO

Disease

Alzheimer's disease;FunDO

Disease

Parkinson disease;FunDO

External Links

Links to cell senescence gene database

1869

Links to epithelial mesenchymal transition gene database

1869

Links to ovarian cancer gene database

1869

Links to endometrial cancer gene database

1869

Links to iHOP

1869

Sequence Information

Nucleotide Sequence

>1869 : length: 2722
TTGGCGCGTAAAAGTGGCCGGGACTTTGCAGGCAGCGGCGGCCGGGGGCGGAGCGGGATC
GAGCCCTCGCCGAGGCCTGCCGCCATGGGCCCGCGCCGCCGCCGCCGCCTGTCACCCGGG
CCGCGCGGGCCGTGAGCGTCATGGCCTTGGCCGGGGCCCCTGCGGGCGGCCCATGCGCGC
CGGCGCTGGAGGCCCTGCTCGGGGCCGGCGCGCTGCGGCTGCTCGACTCCTCGCAGATCG
TCATCATCTCCGCCGCGCAGGACGCCAGCGCCCCGCCGGCTCCCACCGGCCCCGCGGCGC
CCGCCGCCGGCCCCTGCGACCCTGACCTGCTGCTCTTCGCCACACCGCAGGCGCCCCGGC
CCACACCCAGTGCGCCGCGGCCCGCGCTCGGCCGCCCGCCGGTGAAGCGGAGGCTGGACC
TGGAAACTGACCATCAGTACCTGGCCGAGAGCAGTGGGCCAGCTCGGGGCAGAGGCCGCC
ATCCAGGAAAAGGTGTGAAATCCCCGGGGGAGAAGTCACGCTATGAGACCTCACTGAATC
TGACCACCAAGCGCTTCCTGGAGCTGCTGAGCCACTCGGCTGACGGTGTCGTCGACCTGA
ACTGGGCTGCCGAGGTGCTGAAGGTGCAGAAGCGGCGCATCTATGACATCACCAACGTCC
TTGAGGGCATCCAGCTCATTGCCAAGAAGTCCAAGAACCACATCCAGTGGCTGGGCAGCC
ACACCACAGTGGGCGTCGGCGGACGGCTTGAGGGGTTGACCCAGGACCTCCGACAGCTGC
AGGAGAGCGAGCAGCAGCTGGACCACCTGATGAATATCTGTACTACGCAGCTGCGCCTGC
TCTCCGAGGACACTGACAGCCAGCGCCTGGCCTACGTGACGTGTCAGGACCTTCGTAGCA
TTGCAGACCCTGCAGAGCAGATGGTTATGGTGATCAAAGCCCCTCCTGAGACCCAGCTCC
AAGCCGTGGACTCTTCGGAGAACTTTCAGATCTCCCTTAAGAGCAAACAAGGCCCGATCG
ATGTTTTCCTGTGCCCTGAGGAGACCGTAGGTGGGATCAGCCCTGGGAAGACCCCATCCC
AGGAGGTCACTTCTGAGGAGGAGAACAGGGCCACTGACTCTGCCACCATAGTGTCACCAC
CACCATCATCTCCCCCCTCATCCCTCACCACAGATCCCAGCCAGTCTCTACTCAGCCTGG
AGCAAGAACCGCTGTTGTCCCGGATGGGCAGCCTGCGGGCTCCCGTGGACGAGGACCGCC
TGTCCCCGCTGGTGGCGGCCGACTCGCTCCTGGAGCATGTGCGGGAGGACTTCTCCGGCC
TCCTCCCTGAGGAGTTCATCAGCCTTTCCCCACCCCACGAGGCCCTCGACTACCACTTCG
GCCTCGAGGAGGGCGAGGGCATCAGAGACCTCTTCGACTGTGACTTTGGGGACCTCACCC
CCCTGGATTTCTGACAGGGCTTGGAGGGACCAGGGTTTCCAGAGATGCTCACCTTGTCTC
TGCAGCCCTGGAGCCCCCTGTCCCTGGCCGTCCTCCCAGCCTGTTTGGAAACATTTAATT
TATACCCCTCTCCTCTGTCTCCAGAAGCTTCTAGCTCTGGGGTCTGGCTACCGCTAGGAG
GCTGAGCAAGCCAGGAAGGGAAGGAGTCTGTGTGGTGTGTATGTGCATGCAGCCTACACC
CACACGTGTGTACCGGGGGTGAATGTGTGTGAGCATGTGTGTGTGCATGTACCGGGGAAT
GAAGGTGAACATACACCTCTGTGTGTGCACTGCAGACACGCCCCAGTGTGTCCACATGTG
TGTGCATGAGTCCATGTGTGCGCGTGGGGGGGCTCTAACTGCACTTTCGGCCCTTTTGCT
CTGGGGGTCCCACAAGGCCCAGGGCAGTGCCTGCTCCCAGAATCTGGTGCTCTGACCAGG
CCAGGTGGGGAGGCTTTGGCTGGCTGGGCGTGTAGGACGGTGAGAGCACTTCTGTCTTAA
AGGTTTTTTCTGATTGAAGCTTTAATGGAGCGTTATTTATTTATCGAGGCCTCTTTGGTG
AGCCTGGGGAATCAGCAAAGGGGAGGAGGGGTGTGGGGTTGATACCCCAACTCCCTCTAC
CCTTGAGCAAGGGCAGGGGTCCCTGAGCTGTTCTTCTGCCCCATACTGAAGGAACTGAGG
CCTGGGTGATTTATTTATTGGGAAAGTGAGGGAGGGAGACAGACTGACTGACAGCCATGG
GTGGTCAGATGGTGGGGTGGGCCCTCTCCAGGGGGCCAGTTCAGGGCCCCAGCTGCCCCC
CAGGATGGATATGAGATGGGAGAGGTGAGTGGGGGACCTTCACTGATGTGGGCAGGAGGG
GTGGTGAAGGCCTCCCCCAGCCCAGACCCTGTGGTCCCTCCTGCAGTGTCTGAAGCGCCT
GCCTCCCCACTGCTCTGCCCCACCCTCCAATCTGCACTTTGATTTGCTTCCTAACAGCTC
TGTTCCCTCCTGCTTTGGTTTTAATAAATATTTTGATGACGTTTGGGCCGGGTTTTGGGA
CTCTGTTGGGAACATTTCGGGGCGGGAGAGGCCAAGGTTGCTGGGGAAATGCCCATTCTC
CACTTCCCTTCTCCCTGTCCGTGCCCGATTTGATTTGAGCCTCATAACTCGAAGAAAGGT
CAGCTTCCTCGCTGTTTTGGTCCTAACTCAAAAGCAGATCCAGTAAAGGTTTTTGTTGTA
AAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>1869 : length: 437
MALAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISAAQDASAPPAPTGPAAPAAGPCD
PDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVK
SPGEKSRYETSLNLTTKRFLELLSHSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLI
AKKSKNHIQWLGSHTTVGVGGRLEGLTQDLRQLQESEQQLDHLMNICTTQLRLLSEDTDS
QRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSENFQISLKSKQGPIDVFLCPE
ETVGGISPGKTPSQEVTSEEENRATDSATIVSPPPSSPPSSLTTDPSQSLLSLEQEPLLS
RMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEG
IRDLFDCDFGDLTPLDF