ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1820

Name

ARID3A

Synonym

BRIGHT|DRIL1|DRIL3|E2FBP1;AT rich interactive domain 3A (BRIGHT-like);ARID3A;AT rich interactive domain 3A (BRIGHT-like)

Definition

ARID domain-containing 3A|ARID domain-containing protein 3A|AT rich interactive domain 3A (BRIGHT- like) protein|AT-rich interactive domain-containing protein 3A|B-cell regulator of IgH transcription|E2F-binding protein 1|dead ringer-like 1|dead ringer-li

Position

19p13.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Direct p53 effectors;PID Curated;200101

Disease

Vertical cup-disc ratio;NHGRI

External Links

Links to cell senescence gene database

1820

Links to epithelial mesenchymal transition gene database

1820

Links to ovarian cancer gene database

1820

Links to endometrial cancer gene database

1820

Links to iHOP

1820

Sequence Information

Nucleotide Sequence

>1820 : length: 3679
CTGCCCGGCCTGTTTTATTGGCGGCCTGGGCGGGTGGAGGTGTGGCCTGGGCTAGGGGGT
GGCTCGGGTGGGACCCAGGCCCCAGGAGTCTCTGTTCTTCACCCAGGCCATTAGGACTGG
CCCTGGGTGGAAGGCACTCTAGGCTGGGTGAGTGTGTTGCCGTCCGAGACATCTGGCCCA
CTCGGGATCCCAGAGGACCGGGAAACTCCAGACCCCTGTTGCCCTGCAGAGATTGTGGGG
TCTGCGTGGGAGGCTCTGTGGTCACCCAGACCTGGGTTCAAATCCCACCGCCATGTCTCC
AAGCAGAGGATCCCTGAGCCTCAGTTGTCCTCAACCATGAAATGGGACCGCCCTGGTGCC
CCCTTCTCTGACACCTGTTGGTGCCCACCTTAACCTCCTGAACTCGATTCATCCCTCCTT
GAGTGCCATGGGTTGGGGGGGTACTGTTACCCACACTGTTTTGCAGGTAGGGAACCTGAG
GTCCAGAGAAGTTGTGGCTTGGGCGTTGCTGTTGAGTTGTGTGATGGGGGGAGGGTTAGC
CCAGGGCCCGTATACAACAGGCGCTCAATCTCCAGTCTGGCCTGAGATGGGAGGATACCT
AGATACCTGGAGGCCAGGCTGGGCCGCTCCAACAGGGACTCAGGCAGCGACTGGAACTTA
GAACCCACCTGACTGGGGCCCGGAGCCCGCTGGCCAATCACAGGCCAGGAACGCCCATTC
CCCCACCCTGCTTGTGAAGCAATAATCCAAGATCTCCTGGGGCAGACAGTCTGGCCACAG
CGTGTTTCTCTGTGGCCCCGTGCGGGGCGACCTTGCTACCCAGGCCCACAGTAGGCTGTA
TGCGAAGAGCCTGCGCCTCTGCCTCCAAGAAGGCCTCCAGGTTTCTGCAAATGCGTGAAT
GAGCCGGATGCCAGCCTCTGTCCCCTGGAGCCCAGCGTGAGGAAGAGGCATGCCCCATCA
GCCTTCAGCTTGAGCCCGGCGGCCCCCGCCCCCGCCCCCTGCCACCCTGCACTGCCCCGG
CTCCCCCGCGGCCCCCACGCTGCAGTGCGGCCGGGCCCCCTCCCCGCAGGGGCCGCCCCC
GCCGCCCACCCCTAGCGCCCGTGGTGGTGGTGGTGGTGGTGGTGGTGGTGGCCCGGGCCG
CAGGGCCATGAAACTACAGGCCGTGATGGAGACGCTGTTGCAGCGGCAGCAGCGGGCGCG
CCAGGAGCTGGAGGCCCGGCAGCAGCTGCCCCCCGATCCCCCTGCTGCACCCCCCGGCCG
GGCCCGGGCTGCCCCCGACGAGGACAGAGAGCCCGAGAGTGCCCGGATGCAGCGGGCTCA
GATGGCCGCACTGGCAGCCATGCGGGCTGCAGCTGCGGGCCTGGGACACCCAGCCAGCCC
CGGCGGCTCTGAGGATGGGCCCCCAGGCTCGGAGGAGGAGGACGCGGCCCGGGAGGGGAC
ACCGGGCTCACCCGGGCGAGGCAGAGAAGGGCCAGGAGAGGAGCACTTTGAGGACATGGC
CTCCGACGAGGACATGAAGCCCAAATGGGAGGAGGAGGAGATGGAGGAAGACCTCGGGGA
GGATGAGGAGGAGGAGGAGGAGGATTACGAGGATGAGGAGGAGGAGGAGGACGAGGAGGG
GCTGGGCCCCCCAGGCCCTGCCAGCTTGGGCACCACGGCACTGTTCCCCCGAAAGGCCCA
GCCACCCCAGGCCTTCCGCGGCGATGGCGTTCCCAGGGTGCTGGGGGGCCAGGAGCGGCC
GGGGCCTGGCCCTGCCCACCCCGGAGGGGCCGCCCACGTAGCCCCGCAGCTGCAGCCGCC
TGACCACGGCGACTGGACTTACGAGGAGCAGTTTAAGCAGCTCTACGAACTCGACGGGGA
CCCCAAGAGGAAGGAATTCCTGGATGACTTGTTCAGCTTCATGCAGAAGCGAGGGACACC
TGTGAACCGCATCCCCATCATGGCCAAACAGGTCCTTGACCTGTTCATGCTGTACGTGCT
GGTGACGGAGAAGGGCGGCCTCGTGGAGGTCATCAACAAGAAGCTGTGGCGTGAGATCAC
CAAGGGCCTCAACCTGCCCACGTCCATCACCAGTGCAGCCTTCACCCTGCGGACCCAATA
CATGAAGTACCTGTACCCCTACGAGTGTGAGAAGCGGGGCCTCAGTAACCCCAATGAGCT
CCAGGCAGCCATAGACAGCAACCGACGGGAGGGCCGGCGCCAGAGCTTTGGTGGCTCCCT
CTTTGCCTACTCGCCAGGCGGGGCACACGGCATGCTCTCCTCACCCAAGCTACCCGTGTC
CTCCCTGGGCCTGGCCGCAAGCACCAATGGCAGCTCCATCACCCCCGCCCCTAAGATCAA
GAAAGAGGAGGACTCAGCCATCCCCATCACAGTCCCTGGCCGCCTGCCTGTGTCCCTGGC
GGGCCACCCTGTGGTGGCAGCCCAGGCAGCAGCTGTGCAAGCAGCAGCCGCCCAAGCAGC
TGTGGCCGCACAGGCAGCTGCCCTGGAACAGCTGCGGGAGAAGCTGGAGTCTGCAGAGCC
TCCGGAGAAGAAGATGGCCCTGGTGGCCGATGAGCAGCAACGGCTGATGCAACGTGCACT
CCAGCAGAACTTCCTGGCCATGGCGGCCCAGCTGCCCATGAGCATTCGGATCAACAGCCA
AGCCTCCGAAAGCCGCCAGGACTCTGCTGTGAACCTGACGGGCACCAACGGCAGCAACAG
CATCAGCATGTCGGTGGAGATCAACGGCATCATGTACACAGGAGTTCTGTTTGCTCAGCC
GCCGGCCCCCACGCCAACCTCTGCTCCCAACAAAGGAGGCGGCGGCGGCGGCGGCAGCAG
CAGCAACGCAGGCGGCCGGGGAGGAAACACCGGAACCAGCGGCGGCCAGGCTGGGCCAGC
GGGGCTGTCCACACCCTCCACATCTACCTCAAATAACTCGTTGCCTTAACCGCATCACTC
CCCACCCGCCACCCACCCTGGAGCCCGCCGGCCTGGGCAGGGGGTCCAGGTGGGCCACAC
AGGGGCCAGGATGGCGGAAGATACGGGTGGGGAGGGAAGATATCCAGAAAGGAGCCACAG
CTGACGCCAAAAAGAAAAGAAAAAAGATATATATATATATATATATATATACACGTATAT
ATATAAAGAGAATTTAATAAAACAGGGGAAAACCAAGGAACACTTGAATTTCTCAGGTTT
TGGACATTCAGAGAGATGAATTGTGAGAACAGCAAAGAAATCCATCAGAAAAACAGAAAG
AGGCAGACGTTTCCCAGGGCGTTCAGGCAGCCCTGATGGACCGAAGGCTCTGGTGTCTGG
TTTGGCCCCACAGCAGTGTGGGCCGATCCTGTTTACCTCATACATCCCTGCACTGTGTGT
TTTCATTTTTGTCTGCTTTAGTTCTCTTTTATTTTCTATTCACCACACACTCACCACTCC
CAGCTTCTCGTGTCCAGTGAAACCCCTGAACCAAGATCACTGAATTTTTGTTTTTTTCTT
GTTGCTTTGGGAAATTTTTTTTTCTCTGTAGGGTTTTTAAGAGGTTTCGGGGGTTTTGTT
GTGTAAATATTCTATTTTATTCTTGGGGGGATCAAACCTTAGGAAAAGGATATCTATATA
TCTATATAGCTATATATTTGTGTTCCTTCAGGGAAACTGGTCTTGAAAAAGCAAGAAAAA
AAAGCAAAAAAAAAAAAAA

Protein Sequence

>1820 : length: 593
MKLQAVMETLLQRQQRARQELEARQQLPPDPPAAPPGRARAAPDEDREPESARMQRAQMA
ALAAMRAAAAGLGHPASPGGSEDGPPGSEEEDAAREGTPGSPGRGREGPGEEHFEDMASD
EDMKPKWEEEEMEEDLGEDEEEEEEDYEDEEEEEDEEGLGPPGPASLGTTALFPRKAQPP
QAFRGDGVPRVLGGQERPGPGPAHPGGAAHVAPQLQPPDHGDWTYEEQFKQLYELDGDPK
RKEFLDDLFSFMQKRGTPVNRIPIMAKQVLDLFMLYVLVTEKGGLVEVINKKLWREITKG
LNLPTSITSAAFTLRTQYMKYLYPYECEKRGLSNPNELQAAIDSNRREGRRQSFGGSLFA
YSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVSLAGH
PVVAAQAAAVQAAAAQAAVAAQAAALEQLREKLESAEPPEKKMALVADEQQRLMQRALQQ
NFLAMAAQLPMSIRINSQASESRQDSAVNLTGTNGSNSISMSVEINGIMYTGVLFAQPPA
PTPTSAPNKGGGGGGGSSSNAGGRGGNTGTSGGQAGPAGLSTPSTSTSNNSLP