ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1656

Name

DDX6

Synonym

HLR2|P54|RCK;DEAD (Asp-Glu-Ala-Asp) box helicase 6;DDX6;DEAD (Asp-Glu-Ala-Asp) box helicase 6

Definition

ATP-dependent RNA helicase p54|DEAD (Asp-Glu-Ala-Asp) box polypeptide 6|DEAD box protein 6|DEAD box-6|DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 6 (RNA helicase, 54kD)|oncogene RCK|probable ATP-dependent RNA helicase DDX6

Position

11q23.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

mRNA Decay by 5' to 3' Exoribonuclease;PID Reactome;500857

Pathway

Metabolism of RNA;Reactome;REACT:21257

Pathway

RNA degradation;KEGG PATHWAY;hsa03018

Disease

Liver cancer;FunDO

External Links

Links to cell senescence gene database

1656

Links to epithelial mesenchymal transition gene database

1656

Links to ovarian cancer gene database

1656

Links to endometrial cancer gene database

1656

Links to iHOP

1656

Sequence Information

Nucleotide Sequence

>1656 : length: 6246
ATCTTGAGTGGAGGAGGAGCCGCGGTCGCCGCCATGCGGAGAGGCAGGGAAAGAGGGAGG
AGGCGGCGGGCGGGCGAACGGGCGAGCGAGGGAGGGGGCAGAGGAGCCGAGTTAGCTCAG
CCAGGCGGCGACTTCGGCGGCGCCACGAGAGCGGGCAGCGGAGGAGATTGACGTGAGTGA
ATTCAGATATAACTCAAGCTTGTTAGAGGGCTTTTTAAAAATAAAAAGTTGATTCCGTGC
AAGAGAGCAAGTTACTGCTGCTTACCGTTCAGAGACTTACAGGTGCTTGCCTGCATTGCA
ATAAAGGACTCATTTATTGAGCAAGACTTATATTTATCTCTTCATTTTGGAGAGCCTAAT
AAACTGTTATTACAGTTTCTCTACTGACTTTCAAAAGTTTTGAAGTTTGAAAGACCTTTG
CAATTAAAACAGCATGAGCACGGCCAGAACAGAGAACCCTGTTATAATGGGTCTGTCCAG
TCAAAATGGTCAGCTGAGAGGCCCTGTGAAACCCACTGGTGGCCCTGGAGGAGGGGGCAC
ACAGACACAGCAACAGATGAACCAGCTGAAAAACACCAACACAATCAATAATGGCACTCA
GCAGCAAGCACAGAGTATGACCACCACTATTAAACCTGGTGATGACTGGAAAAAGACTTT
AAAACTCCCTCCAAAGGATCTAAGAATCAAAACTTCGGATGTGACCTCCACAAAAGGAAA
TGAGTTTGAAGATTACTGTTTGAAACGGGAGTTACTGATGGGAATTTTTGAAATGGGCTG
GGAAAAGCCATCTCCTATTCAGGAGGAGAGCATTCCCATTGCTTTATCTGGTAGGGATAT
CTTAGCTAGAGCAAAAAATGGAACAGGCAAGAGCGGTGCCTACCTCATTCCCTTACTTGA
ACGGCTAGACCTGAAGAAGGACAATATACAAGCAATGGTGATTGTTCCCACTAGAGAACT
TGCTCTACAGGTCAGTCAAATTTGCATCCAGGTCAGCAAACACATGGGAGGGGCCAAAGT
GATGGCAACCACAGGAGGAACCAATTTACGAGATGACATAATGAGGCTTGATGATACAGT
GCACGTGGTGATTGCTACCCCTGGGAGAATCCTGGATCTTATTAAGAAAGGAGTAGCAAA
GGTTGATCATGTCCAGATGATAGTATTGGATGAGGCAGATAAGTTGCTGTCACAGGATTT
TGTGCAGATAATGGAGGATATTATTCTCACGCTACCTAAAAACAGGCAGATTTTACTATA
TTCCGCTACTTTCCCTCTTAGTGTACAGAAGTTCATGAATTCCCATTTGCAGAAACCCTA
TGAGATTAACCTGATGGAGGAACTAACTCTGAAGGGAGTAACCCAGTACTACGCATATGT
AACTGAGCGCCAAAAAGTACACTGCCTCAACACACTTTTCTCCAGGCTTCAGATAAACCA
GTCGATCATTTTCTGTAACTCCTCTCAGCGAGTTGAATTGCTAGCCAAGAAGATTTCTCA
ACTGGGTTATTCTTGCTTCTATATTCATGCTAAAATGAGGCAGGAACATCGAAATCGTGT
ATTTCATGATTTCCGAAATGGCTTATGCCGCAATCTTGTTTGCACTGATCTGTTTACCCG
AGGTATTGATATACAAGCTGTGAATGTGGTAATAAACTTTGATTTCCCAAAGCTGGCAGA
GACCTATCTCCATCGTATTGGAAGATCAGGTCGCTTTGGTCATCTTGGCTTAGCCATCAA
CTTGATCACATATGATGATCGCTTCAACCTGAAAAGTATTGAGGAGCAGCTGGGAACAGA
AATTAAACCTATTCCGAGCAACATTGATAAGAGCCTGTATGTGGCAGAATACCACAGCGA
GCCTGTAGAAGATGAGAAACCTTAACAAGCATGCTTTGACAAATTACAAAAGGCTCGTTT
GGATCTGTGACACATCGTTTTGGGGGGAATGCTCCTCTCTTTGTGGGTTTTTCATCTTTT
ATTTTGGAACTATGAAGACTTAAAAGAGCTCAGACATTTTCTTTTTTTAACTGGTGAAGA
GAAAAAGGCTGAAAAGAAGGAATATACCTTTTTTGTTCCACTTGTTTGCACTGTGTGCTG
ACTGAACATTAGTTGCACTAACTGCTGGTTTTTAAAAAATGTTTTCTGGGGAAAGGGGAC
AAGGAAGGAAAAGAAAGAAGAGAAGGGGAGAAACCCTAAAAAGAGAAGAATCTTAATGAA
CACACAAGCTTGTCAATGATTTCAAAATTCTCCAACAGCTGACTCTCGTGCATTTCAACT
TCTCCCTGATTCCTCATCCGTTTTTTAAGCCTGAAGAGCTTATTACTTATTTGTGCGAAG
TGCCTTATGCTATGAGACCATTCAGAATATCATCTTTTAGACACAGCCCGAGGAATCAAC
AATAGTAACTCTTTCTTTCCGTTTTTTTTTCTTTTTCTTTTAAAAAATGTCTTCTTATTT
TGGTTTCAGGTTGAAGTCTCTTCCCTTTCTACCCAGTACTCGAGCCCAGGGCTAGAAGTT
GAAACTCACTAGTAATGTTAAACACCATTTTTTTTTTCTTTTTGGGGAGGAGTTGATATG
CAACTGCAGTTCATCCGCACTGTAAATACATGTATTTAAAAAAACAATCCCAAGTAAAAA
TTTCTTCTGGGCTGAGTAGATAAAAAACATCATCGCTCCCAAAGGAAAGAGCAGTCTATC
ATTGCAGGAGCCATATGACAAGCCTTTGTGCTCTATAGCAGACACTAAAGACTGGGTTAC
ATATGCCTCCAGTAGTAGTATGGCACTTGATGTGTAGACATGTCAGAGCCTTGGCCCTCT
TTCCTCTGTGGCAAAGCGTGTCCCATAGAAAATTGGGTGTGTATACTTGTATAACTTTGT
AAATAAGTTTTTTTTCTGGGTTCATATATATATATATATATACATATATATATATTTTTT
TTTGGATGAAGGTTGCTGGGATTAAGGGGATTAGAGTGATTATGGGAGCAGCTAAAGATG
AGAGGGGCTCAGTTTTACGCAACACTAAATTCTAGAAAGTACTTTGGCCTCGTGCTGTAG
AGAGCAGATTTCTATGGTACCCTGTGTTAGTAAAGGGGCCCAGAAATCTGGGATGTACTG
TTTGCTGCCACACTGTCTCATCTAGTACCTTTGGAGTAGGTTTACCAGAGAGAGCAAGGA
AGCTTCAAAACATTGATAATTCAACATTTATTTTGAGAAGCTCTGATTTTGCTTCTTCCC
CCTTTCTAAAAGTTTGAGGAATATTTCAAGCTCTGCAACAGGGGGCAAAGATTAATCTAC
CTTGCAGTGTAGGAATTCTATTGAGTGGCAGTGTCATTGAGCAGTATATATATAAAGCAC
AGATTTGCATTTCAGAATATTAGCCAGTACCAGCTTTGGTAATGTTAGCAGTTCTGGAGC
TTAATTTTCTGTGGATCATTTCCTGTAGTGTGTAAATGTGTTGCCCTCTGCCCGCTTTGA
TACATAAACTTTTGCAGGAATGGGCAACCTGAGAGCTGTTAACTTTCATGCTACAGAAAG
CTGCTTGCCATTCTCTTGCATTGTGACAAGAATTGTTACCTGTCATTTTGCACTGTAAAT
TGCTGGCAGATGCTTTACAGTCAATAGTGTTGCTTTAAATTGTGCCCCTCCCAACATGCT
TGATGTTTGGCCTGATCTCCAGGCAAAAGGAGTGAGATGAATCAAAACCAGTGAACTTTT
TTTTTTAATGTTTTTAATTCCCTTTTAACCCAGTGTACTAGGTCAATCAGGAGGCATCTG
GAAAGGGGGGGAAAAAAGCAAAAAACAAAATTAAAAAAAATTGATTTCCATATTTTATTT
TTCAAAACCCTAAAATATTACAAAATAAGTCCCGCATATACTTTAATGTTTTAACTCTTT
TGGACAAAGGAATCAATTACTTGAAGTTGCTTTTTTGACTCTGCCTACTTCTGAGCAAAC
TATTTGCGACTCACCCACAATTCCTTGGAGATCAAAATCCTACAGATGCCTCCTGATGGG
ACATAGCCCTAACTCCTTAACAACTGTAGCAAGAACTGCACGGTACAAACCCAAAAAAGA
ACAAGCTCATCTATTTGGAACCCAAGCCTCATATTTTCTGTCCAGTCAATGTTGGTTACT
AAATAGAAAACCTAATTAAGGAAGTAACTTTTTTCCAGGGAGGGGTGGGAGAGGGAATTT
AAAAGGTGTCAACTTTTGACCAAAAAAATTGTGCCCTTGTACCGATGCAGCTCTCTTTCT
CCCCCACCTCTTGCGAGATAAGAGGGATCATTCATGTAGAAGAAAAGAGTATAAATGCAA
TTCTGTATCTCGCTAGAGAACGTGTGGGTGACTAAACAAAAAGTGCAGTCTCCTTCACCA
ACTTTAGACTGCGTGGTGCCACATGCCTGTGGGTCCCTCTTAAAGCACAGACTTAAAATG
GAAAGTATTACTGAAGTATAGCCTCTAATGAGGAGTGGCACTTAAACTATCTGGGACACC
ACTACTGGACACGGTCTTGTAGAGGCAGCTGTCCAGTTTTGGTGCTTGACTCTTGAATAG
GAATTGTTAAATGGAAAGATGCTCTGAGGACTAGGTCAAAGCCTGGTCTTTTTTTTTTTT
TTTTTTTTTTTCTTTCTTTTTTGGGCCCTCATAATAAGCATTGTTACTATTGGAAGTTGT
TTTCACATTCTTTCCAATATTAAATATGTATTTTTTTAAGTAATGATAATATTTTCCAGT
GGCTCATTTGGATGAGAACTACCCTCTATTTTTAATATTAAAACTACATCCAACTCATCA
TTTAGCCTTTGGTTGTACAGTTGTGTAATGGGCTATGGACTGTTACACACCTTACCACCT
CTAGGCCTATGTTTTTTCTTTCCCCATATATTCTGATGGGGATAAATACTGTTTTGCCTC
TCCCATAGGAATGGAATACATTTATTCTAAAATGATCTTTCACAGAAGTAAGAGAGAGGG
AAACCTAAATATACCTCTAAATTGTTTGAAGTTGGTCCCAGCAGCATAAAATGGGTTGGC
CCCAAAGGGTTGGAGGGTGGGCTTGGTTATCAGTATTTGTTTTCAGAATGAGATGGGAGC
ATCTTTCCTTTGCCACGTGCTTTGTGCTTGATAACATCATGCTTGGTTCAAACGACAACT
CAGCACAAAGCCTTGAGTATAAATTGTTGGAATCAAAACATCTCATTCTGATGACGTGGT
TTAATTTTTTAATTTTTTTTTTTAATAGGGGTGGGAGGGAGGGTACTTTGCCCCAGAAGG
GAGGGTGTCTGCACTAAGGATTTAGAAACACTTTGGAAGCTCATAACCTCATCAGAAACT
GCCTTTAGCCACACTCCTGACCTTCTAGATGAGTAACAAAAAAATGAAATAAGTTCTTGG
AAATTAAGCCATTTATTTTAATTTGCTATTTTTTTCAATGTTCTAGGTATCTTTAAATTT
GTTATTGTGGAATCATTTTCCTGCCAGATACCTTTATCAAAATTATTGGCCTCATGAGAG
CTGAAGTAAGTCAGCTTTTTGGTGAACTTTAGTGGACTTCTGTGAGATTGTAGTTGTACT
TTGTATCTCTAAATCTAAAGATAGTTTTTTAAAACTCCCAAAGAAAATCTGCTCTCCTTT
CTGATCTAAAAACTCATCTTTGGGGTAAAGAGTTAAGTGTCCAAAGGTTGTCACAGTTCA
TGAGGTCAGAGGGAGCTAGCCTGGCACCTGGACTCTGCCCATCCACAGCTGACAGATTCC
AACAGAAGTGTATTTAAATTCTCCAGTAGACAATGCTGGGTAAGGGAGGGGGTAGGGCTG
GGTTATTAAGATACAGGCTGCTGTATTTTACATTGGTTGTGTGGGAAGGGGAGCCTGGAG
AAAACAAAGTCACTATTCCCTTTTTTGAAACAGGAAAAAAAATTATTTTTTGTTCAGTAA
AAATGGTAGAGAATTCCAATGTCCCTAGCCACAAGGGACCAGTTCCACTGAGAAGTGAAC
AGTGGGAACTCAAAATTTCAGAAACATTGGGGGAAGGGAAAATTGGCTTTCTCTTAATTG
GCAGATGTTCCAGTGGGGGGGGGGGGGGCTCTGTTTTTGTTGGGATGTGTTATGTTGTAT
GTACGCATATATGGACCGGAGTCTGCTGAGTTTATAAGGTTCCAAAAATATGGTAAAATC
TTGGTTTTTGTTAATTTATCTCAATAAAAGCCCACTGGAACTCCAAAAAAAAAAAAAAAA
AAAAAA

Protein Sequence

>1656 : length: 483
MSTARTENPVIMGLSSQNGQLRGPVKPTGGPGGGGTQTQQQMNQLKNTNTINNGTQQQAQ
SMTTTIKPGDDWKKTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPS
PIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQV
SQICIQVSKHMGGAKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHV
QMIVLDEADKLLSQDFVQIMEDIILTLPKNRQILLYSATFPLSVQKFMNSHLQKPYEINL
MEELTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYS
CFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLH
RIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNIDKSLYVAEYHSEPVED
EKP